KEGG   Homo sapiens (human): 10981Help
Entry
10981             CDS       T01001                                 

Gene name
RAB32
Definition
(RefSeq) RAB32, member RAS oncogene family
  KO
K07918  Ras-related protein Rab-32
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10981 (RAB32)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    10981 (RAB32)
Membrane trafficking [BR:hsa04131]
 Others
  Rab GTPases of specific organelles
   Melanosome
    10981 (RAB32)
   Mitochondrion
    10981 (RAB32)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab29/32/38 [OT]
    10981 (RAB32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 PduV-EutP AAA_7 AAA_22 ATP_bind_1 AAA_16 TsaE TniB Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 10981
NCBI-ProteinID: NP_006825
OMIM: 612906
HGNC: 9772
Ensembl: ENSG00000118508
Vega: OTTHUMG00000015755
Pharos: Q13637(Tbio)
UniProt: Q13637
Structure
PDB: 

Position
6q24.3
AA seq 225 aa AA seqDB search
MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGV
DFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKW
KSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNIN
IEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcggaggagccggggaccccggcctgggggcggccgccgccccagcgcccgag
acccgcgagcacctcttcaaggtgctggtgatcggcgagcttggcgtgggcaagaccagc
atcatcaagcgctacgtccaccagctcttctcccagcactaccgggccaccatcggggtg
gacttcgccctcaaggtcctcaactgggacagcaggactctggtgcgcctgcagctgtgg
gacatcgcggggcaggagcgatttggcaacatgacccgagtatactacaaggaagctgtt
ggtgcttttgtagtctttgatatatcaagaagttccacatttgaggcagtcttaaaatgg
aaaagtgatctggatagtaaagttcatcttccaaatggcagccctatccctgctgtcctc
ttggctaacaaatgtgaccagaacaaggacagtagccagagtccttcccaggtggaccaa
ttctgcaaagaacatggctttgccggatggtttgaaacctctgcaaaggataacataaac
atagaggaagctgcccggttcctagtggagaagattcttgtaaaccaccaaagctttcct
aatgaagaaaacgatgtggacaaaattaagctagatcaagagaccttgagagcagagaac
aaatcccagtgttgctga

DBGET integrated database retrieval system