KEGG   Homo sapiens (human): 10982
Entry
10982             CDS       T01001                                 

Gene name
MAPRE2, CSCSC2, EB1, EB2, RP1
Definition
(RefSeq) microtubule associated protein RP/EB family member 2
  KO
K10436  microtubule-associated protein, RP/EB family
Organism
hsa  Homo sapiens (human)
Disease
H01579  Congenital symmetric circumferential skin creases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10982 (MAPRE2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10982 (MAPRE2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     10982 (MAPRE2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     10982 (MAPRE2)
SSDB
Motif
Pfam: EB1 CH CAMSAP_CH ING
Other DBs
NCBI-GeneID: 10982
NCBI-ProteinID: NP_055083
OMIM: 605789
HGNC: 6891
Ensembl: ENSG00000166974
Vega: OTTHUMG00000132551
Pharos: Q15555(Tbio)
UniProt: Q15555 A0A024RC33
Position
18q12.1-q12.2
AA seq 327 aa
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSR
HDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKL
LQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIP
PPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDL
ETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYAS
EEHEGHTEEPEAEEQAHEQQPPQQEEY
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcctgggccgacccaaaccctgtccccaaatggcgagaacaacaacgacatcatccag
gataataacgggaccatcattcctttccggaagcacacagtgcgcggggagcgttcctac
agttggggaatggcggtcaatgtgtattctacctcgataacccaagagactatgagcaga
catgacatcattgcatgggttaatgacatagtatctttaaactacacaaaagtggaacag
ctttgttcaggagcggcctattgccaattcatggacatgctcttccctggctgcattagt
ttgaagaaagtaaaatttcaagcaaagctggaacatgaatatattcacaattttaaactt
ctgcaagcatcatttaagcgaatgaacgttgataaggtaattccagtggagaagctagtg
aaaggacgtttccaggacaacctggattttattcaatggtttaagaaattctatgatgct
aactacgatgggaaggagtatgatcctgtagaggcacgacaagggcaagatgcaattcct
cctcctgaccctggtgaacagatcttcaacctgccaaaaaagtctcaccatgcaaactcc
cccacagcaggtgcagctaaatcaagtccagcagctaaaccaggatccacaccttctcga
ccctcatcagccaaaagggcttcttccagtggctcagcatccaaatccgataaagattta
gaaacgcaggtcatacagcttaatgaacaggtacattcattaaaacttgcccttgaaggc
gtggaaaaggaaagggatttctactttgggaagttgagagagatcgagctactctgccaa
gaacacgggcaggaaaatgatgacctcgtgcagagactaatggacatcctgtatgcttca
gaagaacacgagggccacacagaagagccggaagcagaggagcaagcccacgaacagcag
cccccgcagcaggaagagtactga

DBGET integrated database retrieval system