KEGG   Homo sapiens (human): 10985Help
Entry
10985             CDS       T01001                                 

Gene name
GCN1, GCN1L, GCN1L1, PRIC295
Definition
(RefSeq) GCN1 activator of EIF2AK4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT HEAT_2 HEAT_EZ CLASP_N Cnd1 Vac14_Fab1_bd UME Arm MMS19_N CAAP1
Motif
Other DBs
NCBI-GeneID: 10985
NCBI-ProteinID: NP_006827
OMIM: 605614
HGNC: 4199
Ensembl: ENSG00000089154
Vega: OTTHUMG00000169338
Pharos: Q92616(Tdark)
UniProt: Q92616
Position
12q24.23
AA seq 2671 aa AA seqDB search
MAADTQVSETLKRFAGKVTTASVKERREILSELGKCVAGKDLPEGAVKGLCKLFCLTLHR
YRDAASRRALQAAIQQLAEAQPEATAKNLLHSLQSSGIGSKAGVPSKSSGSAALLALTWT
CLLVRIVFPSRAKRQGDIWNKLVEVQCLLLLEVLGGSHKHAVDGAVKKLTKLWKENPGLV
EQYLSAILSLEPNQNYAGMLGLLVQFCTSHKEMDVVSQHKSALLDFYMKNILMSKVKPPK
YLLDSCAPLLRYLSHSEFKDLILPTIQKSLLRSPENVIETISSLLASVTLDLSQYAMDIV
KGLAGHLKSNSPRLMDEAVLALRNLARQCSDSSAMESLTKHLFAILGGSEGKLTVVAQKM
SVLSGIGSVSHHVVSGPSSQVLNGIVAELFIPFLQQEVHEGTLVHAVSVLALWCNRFTME
VPKKLTEWFKKAFSLKTSTSAVRHAYLQCMLASYRGDTLLQALDLLPLLIQTVEKAASQS
TQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALC
TVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSLGGFKL
AHGLLEELKTVLSSHKVLPLEALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDV
TDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLN
QSSMNAMGSLSVLSPDRVLPQLISTITASVQNPALRLVTREEFAIMQTPAGELYDKSIIQ
SAQQDSIKKANMKRENKAYSFKEQIIELELKEEIKKKKGIKEEVQLTSKQKEMLQAQLDR
EAQVRRRLQELDGELEAALGLLDIILAKNPSGLTQYIPVLVDSFLPLLKSPLAAPRIKNP
FLSLAACVMPSRLKALGTLVSHVTLRLLKPECVLDKSWCQEELSVAVKRAVMLLHTHTIT
SRVGKGEPGAAPLSAPAFSLVFPFLKMVLTEMPHHSEEEEEWMAQILQILTVQAQLRASP
NTPPGRVDENGPELLPRVAMLRLLTWVIGTGSPRLQVLASDTLTTLCASSSGDDGCAFAE
QEEVDVLLCALQSPCASVRETVLRGLMELHMVLPAPDTDEKNGLNLLRRLWVVKFDKEEE
IRKLAERLWSMMGLDLQPDLCSLLIDDVIYHEAAVRQAGAEALSQAVARYQRQAAEVMGR
LMEIYQEKLYRPPPVLDALGRVISESPPDQWEARCGLALALNKLSQYLDSSQVKPLFQFF
VPDALNDRHPDVRKCMLDAALATLNTHGKENVNSLLPVFEEFLKNAPNDASYDAVRQSVV
VLMGSLAKHLDKSDPKVKPIVAKLIAALSTPSQQVQESVASCLPPLVPAIKEDAGGMIQR
LMQQLLESDKYAERKGAAYGLAGLVKGLGILSLKQQEMMAALTDAIQDKKNFRRREGALF
AFEMLCTMLGKLFEPYVVHVLPHLLLCFGDGNQYVREAADDCAKAVMSNLSAHGVKLVLP
SLLAALEEESWRTKAGSVELLGAMAYCAPKQLSSCLPNIVPKLTEVLTDSHVKVQKAGQQ
ALRQIGSVIRNPEILAIAPVLLDALTDPSRKTQKCLQTLLDTKFVHFIDAPSLALIMPIV
QRAFQDRSTDTRKMAAQIIGNMYSLTDQKDLAPYLPSVTPGLKASLLDPVPEVRTVSAKA
LGAMVKGMGESCFEDLLPWLMETLTYEQSSVDRSGAAQGLAEVMAGLGVEKLEKLMPEIV
ATASKVDIAPHVRDGYIMMFNYLPITFGDKFTPYVGPIIPCILKALADENEFVRDTALRA
GQRVISMYAETAIALLLPQLEQGLFDDLWRIRFSSVQLLGDLLFHISGVTGKMTTETASE
DDNFGTAQSNKAIITALGVERRNRVLAGLYMGRSDTQLVVRQASLHVWKIVVSNTPRTLR
EILPTLFGLLLGFLASTCADKRTIAARTLGDLVRKLGEKILPEIIPILEEGLRSQKSDER
QGVCIGLSEIMKSTSRDAVLYFSESLVPTARKALCDPLEEVREAAAKTFEQLHSTIGHQA
LEDILPFLLKQLDDEEVSEFALDGLKQVMAIKSRVVLPYLVPKLTTPPVNTRVLAFLSSV
AGDALTRHLGVILPAVMLALKEKLGTPDEQLEMANCQAVILSVEDDTGHRIIIEDLLEAT
RSPEVGMRQAAAIILNIYCSRSKADYTSHLRSLVSGLIRLFNDSSPVVLEESWDALNAIT
KKLDAGNQLALIEELHKEIRLIGNESKGEHVPGFCLPKKGVTSILPVLREGVLTGSPEQK
EEAAKALGLVIRLTSADALRPSVVSITGPLIRILGDRFSWNVKAALLETLSLLLAKVGIA
LKPFLPQLQTTFTKALQDSNRGVRLKAADALGKLISIHIKVDPLFTELLNGIRAMEDPGV
RDTMLQALRFVIQGAGAKVDAVIRKNIVSLLLSMLGHDEDNTRISSAGCLGELCAFLTEE
ELSAVLQQCLLADVSGIDWMVRHGRSLALSVAVNVAPGRLCAGRYSSDVQEMILSSATAD
RIPIAVSGVRGMGFLMRHHIETGGGQLPAKLSSLFVKCLQNPSSDIRLVAEKMIWWANKD
PLPPLDPQAIKPILKALLDNTKDKNTVVRAYSDQAIVNLLKMRQGEEVFQSLSKILDVAS
LEVLNEVNRRSLKKLASQADSTEQVDDTILT
NT seq 8016 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggacacgcaggtttccgagacactaaagcgttttgcagggaaggtgacaaca
gccagtgtaaaggaacggagagaaatcctcagtgaacttgggaagtgtgttgctggaaaa
gatcttccagagggagcagtgaaggggctctgcaaattgttctgcttgactctgcatcga
tatagagatgcagcctcccgcagggccttgcaggcagccatccagcagttggctgaggcc
cagccagaagccactgctaagaaccttctacactctctgcagtcttctggtataggctcc
aaagcaggtgttcccagtaagagcagtggctctgccgccttgctggccttgacctggacc
tgcctcctggtgcgcattgtctttccatcgagagccaagcgacaaggagacatctggaac
aaactggtggaagtgcagtgcctgctcttgctggaggtgctgggtggctcccacaagcac
gccgtggatggtgctgtgaagaaactcacgaagctgtggaaagagaaccccgggctggtg
gaacagtacttgtcagccattctcagcctagagcccaaccagaactatgctggcatgctg
gggctgctggtgcagttctgcacgagtcacaaggagatggacgtggtcagtcagcacaag
agcgccctactggacttttacatgaagaacatcctgatgagcaaagtcaagcctccgaag
tacctgttggatagctgtgcccctctgctccgatacctgtcccactcagaatttaaggat
ctgatactgcccaccatacagaagtccttactgaggagtccagagaatgttattgaaact
atttctagtctgctggcatcagtgacgcttgacctcagccagtatgccatggacatcgtg
aaaggactggctggtcacctgaaatccaacagtccccgcctgatggatgaagctgtgctg
gcactgcggaacctggcacgccagtgcagtgactcttcggccatggaatccctgaccaag
cacctatttgctatcctcggaggctcggaaggaaaactaactgttgtagcccagaagatg
agcgtcctctcagggattgggagcgtcagtcatcacgtggtgtctggaccttccagtcag
gtcctgaatgggatcgtggctgagctgttcatcccgttccttcagcaggaagttcatgaa
gggaccttggtacacgctgtctcagtcctggctctctggtgtaaccgattcactatggaa
gtgcccaagaagctcactgaatggttcaaaaaagctttcagccttaaaacctccacatct
gcggtgaggcatgcctacctgcagtgcatgttggcctcttaccggggtgacacgctgttg
caggccctggacttactgcccttgctcatccagacagtggagaaggcagcctcccaaagc
actcaggttcccaccatcactgaaggggttgccgcagccttgttgctcttaaagttgtca
gtggctgactcacaggctgaggccaaactgagcagtttctggcagttgattgtggatgag
aaaaagcaggttttcacttctgagaaattcctggtcatggcttcagaggatgccctgtgt
actgtgttgcatctgacagagagacttttccttgaccacccgcatagactcactggcaac
aaagttcagcagtaccaccgggctctggtggcggtgctcctgagccgcacctggcacgtc
cgcaggcaggctcagcagacagttcggaagctgctgtcctctcttgggggctttaagctg
gcgcacggactcttggaggagctgaagactgtcctcagttctcacaaggtgctgccctta
gaggctttggtgactgatgctggagaggtgactgaggcaggcaaggcctacgtgcctcca
cgggtcctgcaggaggctctgtgtgtcatctccggtgtgccagggctcaagggtgatgtc
accgacactgaacaactggcccaggaaatgctgatcatctcccaccacccatccttagtt
gccgtgcagtctggactttggccagcacttcttgccaggatgaagatcgatcctgaagcc
tttatcaccaggcacctggatcagatcattcccaggatgaccacacagagtcccctaaac
cagtcctccatgaatgccatgggctccctttccgtcctgtcgccggaccgggtcctccca
cagctcatcagcaccatcactgcctccgtgcagaaccctgcactgcgcctggtgacgcgg
gaggagtttgccattatgcagacccctgctggggagctgtatgacaaatccatcattcag
agtgcccagcaggacagcataaaaaaggccaacatgaagcgagagaacaaagcttattcc
ttcaaagagcagatcatcgagctggagctgaaggaggagataaagaagaagaaaggcatc
aaagaggaggtgcagctgaccagcaagcagaaggagatgctgcaggcccagctagacagg
gaggcgcaggtccggaggcggctgcaggagctggatggggagctggaggcggcgcttgga
ctgctggacatcatcctggccaagaacccgtccggcctgacccagtacatccctgttttg
gtcgactcttttctgcccttgctgaagtctcccctggctgctcccaggatcaagaacccc
ttcttgtccttggctgcctgtgtcatgccctctaggctcaaggctttgggcactttggtg
agccacgtgaccctgcgcctgctgaagccagagtgtgtcctggataagtcctggtgccag
gaagagctgtcggtggctgtgaagagggcggtgatgctgctgcacacccacaccatcacc
agcagggtgggcaagggggagccaggtgctgcgcccttgtccgcgccagccttctcctta
gtcttcccgtttctgaagatggtgctgacggagatgccccaccacagtgaggaggaggag
gagtggatggcccagattcttcagatcctcactgtccaagcccagctgagggcctccccc
aacaccccacccgggcgggtggacgagaatggcccggagttgctgcctcgcgtggccatg
ctgcgtcttctgacttgggtgatcgggacgggctcgcctcgcttacaggttctggcttca
gacaccctgaccaccctgtgtgccagcagcagtggtgatgatggctgtgcctttgcagag
caggaggaggtggacgtgctgctctgtgccttgcagtccccgtgtgccagcgtgcgggaa
accgtgctccgggggctgatggaactccacatggtattgccagcacctgatactgatgag
aagaatggcctgaaccttctgcggagactctgggtggtcaagtttgacaaggaggaggag
atccggaagctggctgagaggctctggtcaatgatgggcctagacctgcagccagacctc
tgctccttgctgattgacgacgtgatctatcatgaggcggctgtaaggcaggcaggggcc
gaagccctctcccaagcagtggcacgttaccagcggcaggcggcggaggttatgggcagg
ctcatggagatttaccaggaaaagctctaccggccgcccccagtgctggatgctttggga
cgagttatttcagaatctcctccagatcagtgggaagccaggtgtggcttggcgttggcc
ctcaacaagctctcccagtatttggacagctctcaggtgaagccactctttcagtttttt
gtccctgatgccctcaatgaccgacacccagatgtccggaagtgcatgttggatgcagcc
ctcgcaacgctcaacactcatgggaaggagaacgtcaactcgctgttgccagtattcgag
gagttcctgaagaacgcgcccaatgatgccagctatgatgctgtgcgacagagtgtggtg
gtcctgatgggctctctggccaagcacctggacaagagtgaccccaaagtgaagcccatt
gttgccaagctcatcgctgccctctccaccccctcccagcaggtccaggagtccgtagcc
agctgcttgccaccccttgtgccagccatcaaggaggatgctggagggatgatccagagg
cttatgcagcagctgctggagtcagacaagtacgcagagcgcaaaggggccgcctatggc
ctggcgggcctggtgaagggcctgggcatcctctcgctgaagcaacaggagatgatggcg
gcactgactgatgccatccaagataagaagaacttccgccggcgagagggagccctcttt
gccttcgagatgctctgcaccatgctggggaaactttttgagccgtatgtggttcacgtg
ctgccccatctgctcctgtgctttggggatggaaaccagtatgtgcgtgaggctgcagat
gactgtgccaaggctgtgatgagcaacttgagtgctcacggggtgaagctggtgctcccc
tccttactggctgccctggaggaggaatcgtggcggaccaaagctgggtcagtggagctt
cttggggcaatggcgtactgtgctcctaagcagctgtcatcctgtctacccaacattgtg
cccaagcttacggaggtgctgaccgactcccatgtcaaagtccagaaggctggacagcag
gcgctcaggcagatcggctccgttatcaggaacccggagatcctggccattgctccagtc
ctcctggatgccctgacggatccctccaggaagacccagaagtgcttgcagaccctgctg
gacaccaagtttgtccacttcattgatgccccatccctggccctcatcatgcccattgtc
cagagagccttccaggaccgttccacggacacgcggaagatggcagcccagattattggc
aacatgtactccctgacagaccagaaggacttggctccgtacctgcccagcgtgacgcct
ggcctgaaagcatcgcttttggaccctgtgcctgaggtgcggaccgtatctgcaaaggcc
cttggggccatggtgaagggcatgggggagtcgtgctttgaggacttgctgccgtggctg
atggagacactgacctatgagcagagctctgtggatcgctcaggcgctgcacaggggttg
gctgaggtcatggccggtttgggggtggagaagttggagaagttgatgccagaaatcgtg
gctacagccagcaaagtggacattgcaccccatgtccgagatggctacattatgatgttt
aactacctgcccatcacctttggagacaagtttactccttatgtggggcccatcatcccc
tgtatcctcaaagctcttgctgatgagaatgagtttgtgcgtgacaccgccctgcgcgcg
ggccagcgggttatctccatgtacgctgagacagccatcgccctgctgctgccccagcta
gagcaaggcctctttgatgacctttggagaatcaggttcagctctgttcagctccttggg
gatctcctgtttcacatctcaggagtcactgggaagatgaccacagaaactgcctctgag
gatgataactttggaactgcccagtccaacaaggcgatcatcactgccctgggggtagag
cggcggaaccgggtgttggcagggctgtacatgggccgctcagacacccagctggtggtg
cggcaggcgtccctgcatgtctggaagattgttgtctccaataccccccgcaccttgcgt
gagatcctacccactctctttgggctcctgctgggtttcctggccagcacgtgtgcagat
aagagaacgattgcagcgagaacattgggagatcttgtgcggaagttaggggagaaaatc
ctccccgagatcatccccatccttgaggaaggcctgaggtctcagaagagcgatgagagg
cagggtgtgtgcattggcctaagtgagatcatgaagtccaccagccgggatgccgtgctg
tatttctctgaatccctcgtgcccacggcaaggaaggctttgtgtgacccactggaggag
gtcagagaggcggcagccaagactttcgagcagctgcattccaccatcggccaccaggct
ctggaggacattctcccatttttactaaagcagctggatgacgaggaggtgtcagagttt
gccttggatggtctgaagcaagtcatggctattaagagtcgtgtggtgctgccctacctt
gtgcccaagctgacaacgccacctgtcaacacccgggtgctggctttcctttcgtcagtg
gctggtgatgccctcacccgtcatcttggcgtgatcctcccagcggtcatgctggccctg
aaggaaaagcttgggaccccagatgagcagctggagatggccaattgtcaggctgtgatc
ctctccgtagaggatgacacagggcaccggatcatcatcgaggatctgctggaggccacc
cgcagccctgaggtgggcatgaggcaagctgctgccatcatcctcaacatctactgttcc
cgctcaaaggctgactacaccagccacctgcggagcctggtctcgggcctgatccgcctc
ttcaatgactccagccctgtggttctggaggagagctgggatgccctaaatgccatcact
aagaagctggatgctggcaaccagttggcactcattgaagagctgcacaaggaaatccgg
ctcatagggaacgagagcaaaggcgagcatgtgccaggattctgcctcccgaagaaggga
gtgacctccatccttccagtgttgcgggaaggagtcctgactggcagccctgagcagaag
gaggaggcagccaaagccttaggcttggtaatccgcctgacctcggctgacgccctgagg
ccctccgtggtcagcatcactggccctctgatccgcatcctgggggacaggttcagctgg
aatgtgaaggcggctctgctcgagacactcagcctcttgttggctaaggttgggattgcc
ctgaagcccttcctgccccagctgcagaccactttcaccaaagccctgcaggactccaac
cggggggtgcgcctgaaggccgcagatgctctggggaagctcatttccatccacattaag
gtggaccccctcttcacagagctgctcaatggcatccgcgccatggaggacccaggtgtc
agggacaccatgctgcaggccctgaggtttgtgattcagggagcaggggccaaagtggat
gccgtcatccggaaaaacatcgtctcactcctgctgagcatgctgggacacgatgaggac
aacactcgcatctcctcagccgggtgcctaggggaactgtgtgcctttttgactgaagag
gagcttagtgccgttctacagcagtgcttgctggcggacgtgtccggcattgactggatg
gttcggcacgggcggagcctggcactttccgtggctgtgaatgtggctcctggcagactt
tgtgccggcagatatagcagtgatgttcaggaaatgatcctgagcagtgccacggcggac
aggatccccattgcggtgagcggggtccggggcatgggctttctcatgagacaccacatc
gagacaggcggagggcagttgccggccaaactttccagcctgttcgttaagtgtctgcag
aacccatccagcgacatcaggctggtggctgagaagatgatctggtgggcaaataaggac
ccactgcctcccctggacccccaggccatcaagcccatcctgaaggctcttcttgacaac
accaaggataagaacaccgtggtcagggcctacagcgaccaggcaattgtcaacctcctc
aagatgcggcagggtgaagaggtgtttcagtccctctccaagatcctggatgtggccagt
ttggaggtgctgaacgaggttaaccgaaggtccctgaagaagctggccagccaggccgac
tccacggagcaggtggacgacaccatcctgacatga

DBGET integrated database retrieval system