KEGG   Homo sapiens (human): 10987
Entry
10987             CDS       T01001                                 
Symbol
COPS5, CSN5, JAB1, MOV-34, SGN5
Name
(RefSeq) COP9 signalosome subunit 5
  KO
K09613  COP9 signalosome complex subunit 5 [EC:3.4.-.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10987 (COPS5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10987 (COPS5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     10987 (COPS5)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M67
   10987 (COPS5)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    10987 (COPS5)
SSDB
Motif
Pfam: JAB CSN5_C Prok-JAB UPF0172
Other DBs
NCBI-GeneID: 10987
NCBI-ProteinID: NP_006828
OMIM: 604850
HGNC: 2240
Ensembl: ENSG00000121022
Pharos: Q92905(Tbio)
UniProt: Q92905 A0A024R7W9
Structure
Position
8:complement(67043079..67062133)
AA seq 334 aa
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcggcgtccgggagcggtatggcccagaaaacctgggaactggccaacaacatgcag
gaagctcagagtatcgatgaaatctacaaatacgacaagaaacagcagcaagaaatcctg
gcggcgaagccctggactaaggatcaccattactttaagtactgcaaaatctcagcattg
gctctgctgaagatggtgatgcatgccagatcgggaggcaacttggaagtgatgggtctg
atgctaggaaaggtggatggtgaaaccatgatcattatggacagttttgctttgcctgtg
gagggcactgaaacccgagtaaatgctcaggctgctgcatatgaatacatggctgcatac
atagaaaatgcaaaacaggttggccgccttgaaaatgcaatcgggtggtatcatagccac
cctggctatggctgctggctttctgggattgatgttagtactcagatgctcaatcagcag
ttccaggaaccatttgtagcagtggtgattgatccaacaagaacaatatccgcagggaaa
gtgaatcttggcgcctttaggacatacccaaagggctacaaacctcctgatgaaggacct
tctgagtaccagactattccacttaataaaatagaagattttggtgtacactgcaaacaa
tattatgccttagaagtctcatatttcaaatcctctttggatcgcaaattgcttgagctg
ttgtggaataaatactgggtgaatacgttgagttcttctagcttgcttactaatgcagac
tataccactggtcaggtctttgatttgtctgaaaagttagagcagtcagaagcccagctg
ggacgagggagtttcatgttgggtttagaaacgcatgaccgaaaatcagaagacaaactt
gccaaagctacaagagacagctgtaaaactaccatagaagctatccatggattgatgtct
caggttattaaggataaactgtttaatcaaattaacatctcttaa

DBGET integrated database retrieval system