KEGG   Homo sapiens (human): 10988Help
Entry
10988             CDS       T01001                                 

Gene name
METAP2, MAP2, MNPEP, p67eIF2
Definition
(RefSeq) methionyl aminopeptidase 2
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10988 (METAP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     10988 (METAP2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M24
   10988 (METAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24 CDT1_C
Motif
Other DBs
NCBI-GeneID: 10988
NCBI-ProteinID: NP_006829
OMIM: 601870
HGNC: 16672
Ensembl: ENSG00000111142
Vega: OTTHUMG00000170280
Pharos: P50579(Tchem)
UniProt: P50579 A0A140VJE3
Structure
PDB: 

Position
12q22
AA seq 478 aa AA seqDB search
MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKES
GASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPI
CDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVR
KYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTT
VLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV
GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEV
YAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgtggaggaggtagcggcctccgggagccacctgaatggcgacctggatcca
gacgacagggaagaaggagctgcctctacggctgaggaagcagccaagaaaaaaagacga
aagaagaagaagagcaaagggccttctgcagcaggggaacaggaacctgataaagaatca
ggagcctcagtggatgaagtagcaagacagttggaaagatcagcattggaagataaagaa
agagatgaagatgatgaagatggagatggcgatggagatggagcaactggaaagaagaag
aaaaagaagaagaagaagagaggaccaaaagttcaaacagaccctccctcagttccaata
tgtgacctgtatcctaatggtgtatttcccaaaggacaagaatgcgaatacccacccaca
caagatgggcgaacagctgcttggagaactacaagtgaagaaaagaaagcattagatcag
gcaagtgaagagatttggaatgattttcgagaagctgcagaagcacatcgacaagttaga
aaatacgtaatgagctggatcaagcctgggatgacaatgatagaaatctgtgaaaagttg
gaagactgttcacgcaagttaataaaagagaatggattaaatgcaggcctggcatttcct
actggatgttctctcaataattgtgctgcccattatactcccaatgccggtgacacaaca
gtattacagtatgatgacatctgtaaaatagactttggaacacatataagtggtaggatt
attgactgtgcttttactgtcacttttaatcccaaatatgatacgttattaaaagctgta
aaagatgctactaacactggaataaagtgtgctggaattgatgttcgtctgtgtgatgtt
ggtgaggccatccaagaagttatggagtcctatgaagttgaaatagatgggaagacatat
caagtgaaaccaatccgtaatctaaatggacattcaattgggcaatatagaatacatgct
ggaaaaacagtgccgattgtgaaaggaggggaggcaacaagaatggaggaaggagaagta
tatgcaattgaaacctttggtagtacaggaaaaggtgttgttcatgatgatatggaatgt
tcacattacatgaaaaattttgatgttggacatgtgccaataaggcttccaagaacaaaa
cacttgttaaatgtcatcaatgaaaactttggaacccttgccttctgccgcagatggctg
gatcgcttgggagaaagtaaatacttgatggctctgaagaatctgtgtgacttgggcatt
gtagatccatatccaccattatgtgacattaaaggatcatatacagcgcaatttgaacat
accatcctgttgcgtccaacatgtaaagaagttgtcagcagaggagatgactattaa

DBGET integrated database retrieval system