KEGG   Homo sapiens (human): 10989
Entry
10989             CDS       T01001                                 

Gene name
IMMT, HMP, MICOS60, MINOS2, Mic60, P87, P87/89, P89, PIG4, PIG52
Definition
(RefSeq) inner membrane mitochondrial protein
  KO
K17785  MICOS complex subunit MIC60
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10989 (IMMT)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MICOS complex
    10989 (IMMT)
   MICOS complex (yeast)
    10989 (IMMT)
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    10989 (IMMT)
SSDB
Motif
Pfam: Mitofilin
Other DBs
NCBI-GeneID: 10989
NCBI-ProteinID: NP_006830
OMIM: 600378
HGNC: 6047
Ensembl: ENSG00000132305
Vega: OTTHUMG00000153170
Pharos: Q16891(Tbio)
UniProt: Q16891
Position
2p11.2; 2
AA seq 758 aa
MLRACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGG
TILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKE
SKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGK
PTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIA
AQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKE
ELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHE
LVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDDLNSLIAHAHRRIDQLNRELA
EQKATEKQHITLALEKQKLEEKRAFDSAVAKALEHHRSEIQAEQDRKIEEVRDAMENEMR
TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDIN
TAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAETPTIPLGSAVEAIK
ANCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFL
SYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRV
AQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQPE
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgctgcgggcctgtcagttatcgggtgtgaccgccgccgcccagagttgtctctgtggg
aagtttgtcctccgtccattgcgaccatgccgcagatactctacttcaggcagctctggg
ttgactactggcaaaattgctggagctggccttttgtttgttggtggaggtattggtggc
actatcctatatgccaaatgggattcccatttccgggaaagtgtagagaaaaccatacct
tactcagacaaactcttcgagatggttcttggtcctgcagcttataatgttccattgcca
aagaaatcgattcagtcgggtccactaaaaatctctagtgtatcagaagtaatgaaagaa
tctaaacagcctgcctcacaactccaaaaacaaaagggagatactccagcttcagcaaca
gcacctacagaagcggctcaaattatttctgcagcaggtgataccctgtcggtcccagcc
cctgcagttcagcctgaggaatctttaaaaactgatcaccctgaaattggtgaaggaaaa
cccacacctgcactttcagaagaagcatcctcatcttctataagggagcgaccacctgaa
gaagttgcagctcgccttgcacaacaggaaaaacaagaacaagttaaaattgagtctcta
gccaagagcttagaagatgctctgaggcaaactgcaagtgtcactctgcaggctattgca
gctcagaatgctgcggtccaggctgtcaatgcacactccaacatattgaaagccgccatg
gacaattctgagattgcaggcgagaagaaatctgctcagtggcgcacagtggagggtgca
ttgaaggaacgcagaaaggcagtagatgaagctgccgatgcccttctcaaagccaaagaa
gagttagagaagatgaaaagtgtgattgaaaatgcaaagaaaaaagaggttgctggggcc
aagcctcatataactgctgcagagggtaaacttcacaacatgatagttgatctggataat
gtggtcaaaaaggtccaagcagctcagtctgaggctaaggttgtatctcagtatcatgag
ctggtggtccaagctcgggatgactttaaacgagagctggacagtattactccagaagtc
cttcctgggtggaaaggaatgagtgtttcagacttagctgacaagctctctactgatgat
ctgaactccctcattgctcatgcacatcgtcgtattgatcagctgaacagagagctggca
gaacagaaggccaccgaaaagcagcacatcacgttagccttggagaaacaaaagctggaa
gaaaagcgggcatttgactctgcagtagcaaaagcattagaacatcacagaagtgaaata
caggctgaacaggacagaaagatagaagaagtcagagatgccatggaaaatgaaatgaga
acccagcttcgccgacaggcagctgcccacactgatcacttgcgagatgtccttagggta
caagaacaggaattgaagtctgaatttgagcagaacctgtctgagaaactctctgaacaa
gaattacaatttcgtcgtctcagtcaagagcaagttgacaactttactctggatataaat
actgcctatgccagactcagaggaatcgaacaggctgttcagagccatgcagttgctgaa
gaggaagccagaaaagcccaccaactctggctttcagtggaggcattaaagtacagcatg
aagacctcatctgcagaaacacctactatcccgctgggtagtgcagttgaggccatcaaa
gccaactgttctgataatgaattcacccaagctttaaccgcagctatccctccagagtcc
ctgacccgtggggtgtacagtgaagagacccttagagcccgtttctatgctgttcaaaaa
ctggcccgaagggtagcaatgattgatgaaaccagaaatagcttgtaccagtacttcctc
tcctacctacagtccctgctcctattcccacctcagcaactgaagccgcccccagagctc
tgccctgaggatataaacacatttaaattactgtcatatgcttcctattgcattgagcat
ggtgatctggagctagcagcaaagtttgtcaatcagctgaagggggaatccagacgagtg
gcacaggactggctgaaggaagcccgaatgaccctagaaacgaaacagatagtggaaatc
ctgacagcatatgccagcgccgtaggaataggaaccactcaggtgcagccagagtga

DBGET integrated database retrieval system