KEGG   Homo sapiens (human): 11000Help
Entry
11000             CDS       T01001                                 

Gene name
SLC27A3, ACSVL3, FATP3, VLCS-3
Definition
(RefSeq) solute carrier family 27 member 3
  KO
K08772  solute carrier family 27 (fatty acid transporter), member 3 [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    11000 (SLC27A3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    11000 (SLC27A3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    11000 (SLC27A3)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     11000 (SLC27A3)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   11000 (SLC27A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   11000 (SLC27A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 11000
NCBI-ProteinID: NP_077306
OMIM: 604193
HGNC: 10997
Ensembl: ENSG00000143554
Vega: OTTHUMG00000037155
Pharos: Q5K4L6(Tbio)
UniProt: Q5K4L6 X6R3N0
Position
1q21.3
AA seq 683 aa AA seqDB search
MAALLLLPLLLLLPLLLLKLHLWPQLRWLPADLAFAVRALCCKRALRARALAAAAADPEG
PEGGCSLAWRLAELAQQRAAHTFLIHGSRRFSYSEAERESNRAARAFLRALGWDWGPDGG
DSGEGSAGEGERAAPGAGDAAAGSGAEFAGGDGAARGGGAAAPLSPGATVALLLPAGPEF
LWLWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGARALVLAPEFLESLEPDLPALRAMGL
HLWAAGPGTHPAGISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARI
SHLKILQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQF
WEDCQQHRVTVFQYIGELCRYLVNQPPSKAERGHKVRLAVGSGLRPDTWERFVRRFGPLQ
VLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMAT
SPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFRPGDVFFNTGDLLVCDDQGFLRF
HDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPPHAL
DLMQLYTHVSENLPPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSDPLYVLDQ
AVGAYLPLTTARYSALLAGNLRI
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctcctgctgctgcccctgctgctgttgctaccgctgctgctgctgaagcta
cacctctggccgcagttgcgctggcttccggcggacttggcctttgcggtgcgagctctg
tgctgcaaaagggctcttcgagctcgcgccctggccgcggctgccgccgacccggaaggt
cccgaggggggctgcagcctggcctggcgcctcgcggaactggcccagcagcgcgccgcg
cacacctttctcattcacggctcgcggcgctttagctactcagaggcggagcgcgagagt
aacagggctgcacgcgccttcctacgtgcgctaggctgggactggggacccgacggcggc
gacagcggcgaggggagcgctggagaaggcgagcgggcagcgccgggagccggagatgca
gcggccggaagcggcgcggagtttgccggaggggacggtgccgccagaggtggaggagcc
gccgcccctctgtcacctggagcaactgtggcgctgctcctccccgctggcccagagttt
ctgtggctctggttcgggctggccaaggccggcctgcgcactgcctttgtgcccaccgcc
ctgcgccggggccccctgctgcactgcctccgcagctgcggcgcgcgcgcgctggtgctg
gcgccagagtttctggagtccctggagccggacctgcccgccctgagagccatggggctc
cacctgtgggctgcaggcccaggaacccaccctgctggaattagcgatttgctggctgaa
gtgtccgctgaagtggatgggccagtgccaggatacctctcttccccccagagcataaca
gacacgtgcctgtacatcttcacctctggcaccacgggcctccccaaggctgctcggatc
agtcatctgaagatcctgcaatgccagggcttctatcagctgtgtggtgtccaccaggaa
gatgtgatctacctcgccctcccactctaccacatgtccggttccctgctgggcatcgtg
ggctgcatgggcattggggccacagtggtgctgaaatccaagttctcggctggtcagttc
tgggaagattgccagcagcacagggtgacggtgttccagtacattggggagctgtgccga
taccttgtcaaccagcccccgagcaaggcagaacgtggccataaggtccggctggcagtg
ggcagcgggctgcgcccagatacctgggagcgttttgtgcggcgcttcgggcccctgcag
gtgctggagacatatggactgacagagggcaacgtggccaccatcaactacacaggacag
cggggcgctgtggggcgtgcttcctggctttacaagcatatcttccccttctccttgatt
cgctatgatgtcaccacaggagagccaattcgggacccccaggggcactgtatggccaca
tctccaggtgagccagggctgctggtggccccggtaagccagcagtccccattcctgggc
tatgctggcgggccagagctggcccaggggaagttgctaaaggatgtcttccggcctggg
gatgttttcttcaacactggggacctgctggtctgcgatgaccaaggttttctccgcttc
catgatcgtactggagacaccttcaggtggaagggggagaatgtggccacaaccgaggtg
gcagaggtcttcgaggccctagattttcttcaggaggtgaacgtctatggagtcactgtg
ccagggcatgaaggcagggctggaatggcagccctagttctgcgtcccccccacgctttg
gaccttatgcagctctacacccacgtgtctgagaacttgccaccttatgcccggccccga
ttcctcaggctccaggagtctttggccaccacagagaccttcaaacagcagaaagttcgg
atggcaaatgagggcttcgaccccagcaccctgtctgacccactgtacgttctggaccag
gctgtaggtgcctacctgcccctcacaactgcccggtacagcgccctcctggcaggaaac
cttcgaatctga

DBGET integrated database retrieval system