KEGG   Homo sapiens (human): 11004Help
Entry
11004             CDS       T01001                                 

Gene name
KIF2C, CT139, KNSL6, MCAK
Definition
(RefSeq) kinesin family member 2C
  KO
K10393  kinesin family member 2/24
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    11004 (KIF2C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    11004 (KIF2C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     11004 (KIF2C)
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    11004 (KIF2C)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     11004 (KIF2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd Rho_Binding Fib_alpha DUF4168
Motif
Other DBs
NCBI-GeneID: 11004
NCBI-ProteinID: NP_006836
OMIM: 604538
HGNC: 6393
Ensembl: ENSG00000142945
Vega: OTTHUMG00000008416
Pharos: Q99661(Tbio)
UniProt: Q99661 A0A140VKF1
Structure
PDB: 

Position
1p34.1
AA seq 725 aa AA seqDB search
MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDD
VAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSEL
RITAQENDMEVELPAAANSRKQFSVPPAPTRPSCPAVAEIPLRMVSEEMEEQVHSIRGSS
SANPVNSVRRKSCLVKEVEKMKNKREEKKAQNSEMRMKRAQEYDSSFPNWEFARMIKEFR
ATLECHPLTMTDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPKLKVDL
TKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGG
DLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLR
VLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSACRTSGQTFANSNSSRSHACFQIILRA
KGRMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFR
ESKLTQVLRDSFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLI
QMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGP
DWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDVIKALRLAMQLEEQASRQISS
KKRPQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggccatggactcgtcgcttcaggcccgcctgtttcccggtctcgctatcaagatccaa
cgcagtaatggtttaattcacagtgccaatgtaaggactgtgaacttggagaaatcctgt
gtttcagtggaatgggcagaaggaggtgccacaaagggcaaagagattgattttgatgat
gtggctgcaataaacccagaactcttacagcttcttcccttacatccgaaggacaatctg
cccttgcaggaaaatgtaacaatccagaaacaaaaacggagatccgtcaactccaaaatt
cctgctccaaaagaaagtcttcgaagccgctccactcgcatgtccactgtctcagagctt
cgcatcacggctcaggagaatgacatggaggtggagctgcctgcagctgcaaactcccgc
aagcagttttcagttcctcctgcccccactaggccttcctgccctgcagtggctgaaata
ccattgaggatggtcagcgaggagatggaagagcaagtccattccatccgaggcagctct
tctgcaaaccctgtgaactcagttcggaggaaatcatgtcttgtgaaggaagtggaaaaa
atgaagaacaagcgagaagagaagaaggcccagaactctgaaatgagaatgaagagagct
caggagtatgacagtagttttccaaactgggaatttgcccgaatgattaaagaatttcgg
gctactttggaatgtcatccacttactatgactgatcctatcgaagagcacagaatatgt
gtctgtgttaggaaacgcccactgaataagcaagaattggccaagaaagaaattgatgtg
atttccattcctagcaagtgtctcctcttggtacatgaacccaagttgaaagtggactta
acaaagtatctggagaaccaagcattctgctttgactttgcatttgatgaaacagcttcg
aatgaagttgtctacaggttcacagcaaggccactggtacagacaatctttgaaggtgga
aaagcaacttgttttgcatatggccagacaggaagtggcaagacacatactatgggcgga
gacctctctgggaaagcccagaatgcatccaaagggatctatgccatggcctcccgggac
gtcttcctcctgaagaatcaaccctgctaccggaagttgggcctggaagtctatgtgaca
ttcttcgagatctacaatgggaagctgtttgacctgctcaacaagaaggccaagctgcgc
gtgctggaggacggcaagcaacaggtgcaagtggtggggctgcaggagcatctggttaac
tctgctgatgatgtcatcaagatgatcgacatgggcagcgcctgcagaacctctgggcag
acatttgccaactccaattcctcccgctcccacgcgtgcttccaaattattcttcgagct
aaagggagaatgcatggcaagttctctttggtagatctggcagggaatgagcgaggcgcg
gacacttccagtgctgaccggcagacccgcatggagggcgcagaaatcaacaagagtctc
ttagccctgaaggagtgcatcagggccctgggacagaacaaggctcacaccccgttccgt
gagagcaagctgacacaggtgctgagggactccttcattggggagaactctaggacttgc
atgattgccacgatctcaccaggcataagctcctgtgaatatactttaaacaccctgaga
tatgcagacagggtcaaggagctgagcccccacagtgggcccagtggagagcagttgatt
caaatggaaacagaagagatggaagcctgctctaacggggcgctgattccaggcaattta
tccaaggaagaggaggaactgtcttcccagatgtccagctttaacgaagccatgactcag
atcagggagctggaggagaaggctatggaagagctcaaggagatcatacagcaaggacca
gactggcttgagctctctgagatgaccgagcagccagactatgacctggagacctttgtg
aacaaagcggaatctgctctggcccagcaagccaagcatttctcagccctgcgagatgtc
atcaaggccttgcgcctggccatgcagctggaagagcaggctagcagacaaataagcagc
aagaaacggccccagtga

DBGET integrated database retrieval system