KEGG   Homo sapiens (human): 11006Help
Entry
11006             CDS       T01001                                 

Gene name
LILRB4, CD85K, ILT-3, ILT3, LIR-5, LIR5
Definition
(RefSeq) leukocyte immunoglobulin like receptor B4
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    11006 (LILRB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    11006 (LILRB4)
CD molecules [BR:hsa04090]
 Proteins
  11006 (LILRB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 ig Ig_3 DUF4808
Motif
Other DBs
NCBI-GeneID: 11006
NCBI-ProteinID: NP_001265355
OMIM: 604821
HGNC: 6608
Ensembl: ENSG00000186818
Vega: OTTHUMG00000065879
Pharos: Q8NHJ6(Tbio)
UniProt: Q8NHJ6
Structure
PDB: 

Position
19q13.42
AA seq 448 aa AA seqDB search
MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRL
DKEESPAPWDRQNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGA
YSKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERAAHPLLHLRSEHGAQQHQAEF
PMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEGPRPSPTRSVSTAAGPED
QPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLLQHWRQGKHRTLAQRQADFQR
PPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTY
AKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYARLHSFTL
RQKATEPPPSQEGASPAEPSVYATLAIH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgatccccaccttcacggctctgctctgcctcgggctgagtctgggccccaggacccac
atgcaggcagggcccctccccaaacccaccctctgggctgagccaggctctgtgatcagc
tgggggaactctgtgaccatctggtgtcaggggaccctggaggctcgggagtaccgtctg
gataaagaggaaagcccagcaccctgggacagacagaacccactggagcccaagaacaag
gccagattctccatcccatccatgacagaggactatgcagggagataccgctgttactat
cgcagccctgtaggctggtcacagcccagtgaccccctggagctggtgatgacaggagcc
tacagtaaacccaccctttcagccctgccgagtcctcttgtgacctcaggaaagagcgtg
accctgctgtgtcagtcacggagcccaatggacacttttcttctgatcaaggagcgggca
gcccatcccctactgcatctgagatcagagcacggagctcagcagcaccaggctgaattc
cccatgagtcctgtgacctcagtgcacggggggacctacaggtgcttcagctcacacggc
ttctcccactacctgctgtcacaccccagtgaccccctggagctcatagtctcaggatcc
ttggagggtcccaggccctcacccacaaggtccgtctcaacagctgcaggccctgaggac
cagcccctcatgcctacagggtcagtcccccacagtggtctgagaaggcactgggaggta
ctgatcggggtcttggtggtctccatcctgcttctctccctcctcctcttcctcctcctc
caacactggcgtcagggaaaacacaggacattggcccagagacaggctgatttccaacgt
cctccaggggctgccgagccagagcccaaggacgggggcctacagaggaggtccagccca
gctgctgacgtccagggagaaaacttctgtgctgccgtgaagaacacacagcctgaggac
ggggtggaaatggacactcggcagagcccacacgatgaagacccccaggcagtgacgtat
gccaaggtgaaacactccagacctaggagagaaatggcctctcctccctccccactgtct
ggggaattcctggacacaaaggacagacaggcagaagaggacagacagatggacactgag
gctgctgcatctgaagccccccaggatgtgacctacgcccggctgcacagctttaccctc
agacagaaggcaactgagcctcctccatcccaggaaggggcctctccagctgagcccagt
gtctatgccactctggccatccactaa

DBGET integrated database retrieval system