KEGG   Homo sapiens (human): 110117499Help
Entry
110117499         CDS       T01001                                 

Definition
(RefSeq) LOC110117498-PIK3R3 readthrough
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Mod_r Bap31_Bap29_C
Motif
Other DBs
NCBI-GeneID: 110117499
NCBI-ProteinID: NP_001290356
Ensembl: ENSG00000278139
UniProt: Q68CY7 F6TDL0 Q7Z3W2 B4DXM8
Position
1
AA seq 507 aa AA seqDB search
MGPSRLVRGPRPQGMRSPYRRPGMGWPRPRFPRMFKCSRRRYQQGLRGRTASSAAINPAT
RAMGINNTHTDTTIVWIFPPQALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDISREE
VNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVV
ELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKE
YDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIE
RIMMNYDKLKSRLGEIHDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLV
WLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYG
KPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQ
TSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggggccatctcggcttgtccgtggccctcggccccagggcatgcgttccccctaccgc
aggccaggtatgggctggcccaggccccgatttcccaggatgttcaagtgtagccgcaga
agatatcaacagggtctccgaggtcgaactgccagcagtgcagccatcaatcctgccacc
agggccatgggtatcaacaacacccacactgacaccaccatagtgtggatcttcccacct
caagctcttccaccaaagccacctaagccaatgacttcagcagttccaaatggaatgaag
gacagttctgtttctcttcaggatgcagaatggtactggggggatatttcaagggaggag
gtaaatgacaaattgcgggatatgccagatgggaccttcttggtccgagatgcctcaaca
aaaatgcagggagattatactttgactttgcggaagggaggcaataataagttaataaag
atctatcaccgggatggtaaatatggcttttctgatcctctgacatttaattccgtggtg
gagctcattaaccactatcaccatgaatctcttgctcagtacaatcccaaacttgatgtg
aagctgatgtacccagtgtccagataccaacaggatcagttggtaaaagaagataatatt
gatgcagtaggtaaaaaactgcaagaataccactctcagtatcaggagaagagtaaagag
tatgataggctgtatgaagaatatactagaacatcccaggaaatacagatgaagaggact
gcaatagaagcttttaatgaaacaattaaaatatttgaagagcagtgtcacacacaagaa
caacatagcaaagaatatattgagcgatttcgcagagaggggaatgaaaaggagattgaa
cgaattatgatgaattatgataaattgaaatcacgtctgggtgagattcatgatagcaaa
atgcgtctagagcaggatttgaagaatcaagctttggacaaccgagaaatagataaaaaa
atgaatagcatcaaacctgacctgatccagctgcgaaagatccgagatcaacaccttgta
tggctcaatcacaaaggagtgagacagaaacgcctgaatgtctggctgggaattaagaat
gaggatgctgatgagaactattttatcaatgaggaagatgaaaacctgccccattatgat
gagaaaacctggtttgttgaggatatcaatcgagtacaagcagaggacttgctttatggg
aaacctgatggtgcattcttaattcgtgagagtagcaagaaaggatgctatgcttgctct
gtggtggccgatggggaagtgaagcactgtgtgatctacagcactgctcggggctatggc
tttgcagagccctacaacctgtacagctctctgaaggagctagtgctccattaccagcag
acatccttggttcagcacaacgactccctcaacgtcaggcttgcctaccctgttcatgca
cagatgccctcgctttgcagataa

DBGET integrated database retrieval system