KEGG   Homo sapiens (human): 11012
Entry
11012             CDS       T01001                                 

Gene name
KLK11, PRSS20, TLSP
Definition
(RefSeq) kallikrein related peptidase 11
  KO
K09620  kallikrein 11 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    11012 (KLK11)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     11012 (KLK11)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   11012 (KLK11)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 11012
NCBI-ProteinID: NP_659196
OMIM: 604434
HGNC: 6359
Ensembl: ENSG00000167757
Vega: OTTHUMG00000182915
Pharos: Q9UBX7(Tbio)
UniProt: Q9UBX7
Position
19q13.41
AA seq 282 aa
MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFEC
KPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRT
ATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWG
STSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLV
CNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN
NT seq 849 nt   +upstreamnt  +downstreamnt
atgcagaggttgaggtggctgcgggactggaagtcatcgggcagaggtctcacagcagcc
aaggaacctggggcccgctcctcccccctccaggccatgaggattctgcagttaatcctg
cttgctctggcaacagggcttgtagggggagagaccaggatcatcaaggggttcgagtgc
aagcctcactcccagccctggcaggcagccctgttcgagaagacgcggctactctgtggg
gcgacgctcatcgcccccagatggctcctgacagcagcccactgcctcaagccccgctac
atagttcacctggggcagcacaacctccagaaggaggagggctgtgagcagacccggaca
gccactgagtccttcccccaccccggcttcaacaacagcctccccaacaaagaccaccgc
aatgacatcatgctggtgaagatggcatcgccagtctccatcacctgggctgtgcgaccc
ctcaccctctcctcacgctgtgtcactgctggcaccagctgcctcatttccggctggggc
agcacgtccagcccccagttacgcctgcctcacaccttgcgatgcgccaacatcaccatc
attgagcaccagaagtgtgagaacgcctaccccggcaacatcacagacaccatggtgtgt
gccagcgtgcaggaagggggcaaggactcctgccagggtgactccgggggccctctggtc
tgtaaccagtctcttcaaggcattatctcctggggccaggatccgtgtgcgatcacccga
aagcctggtgtctacacgaaagtctgcaaatatgtggactggatccaggagacgatgaag
aacaattag

DBGET integrated database retrieval system