KEGG   Homo sapiens (human): 11014
Entry
11014             CDS       T01001                                 
Symbol
KDELR2, ELP-1, ELP1, ERD2.2, OI21
Name
(RefSeq) KDEL endoplasmic reticulum protein retention receptor 2
  KO
K10949  ER lumen protein retaining receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05110  Vibrio cholerae infection
Network
nt06180  Pathogenic Escherichia coli
  Element
N01293  COPI vesicle formation
Disease
H00506  Osteogenesis imperfecta
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    11014 (KDELR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11014 (KDELR2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    11014 (KDELR2)
SSDB
Motif
Pfam: ER_lumen_recept PQ-loop
Other DBs
NCBI-GeneID: 11014
NCBI-ProteinID: NP_006845
OMIM: 609024
HGNC: 6305
Ensembl: ENSG00000136240
Position
7:complement(6461089..6484152)
AA seq 212 aa
MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYN
TSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILW
TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIA
VVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaacattttccggctgactggggacctgtcccacctggcggccatcgtcatcctgctg
ctgaagatctggaagacgcgctcctgcgccggtatttctgggaaaagccagcttctgttt
gcactggtcttcacaactcgttacctggatctttttacttcatttatttcattgtataac
acatctatgaaggttatctaccttgcctgctcctatgccacagtgtacctgatctacctg
aaatttaaggcaacctacgatggaaatcatgataccttccgagtggagtttctggtggtc
cctgtgggaggcctctcatttttagttaatcacgatttctctcctcttgagatcctctgg
accttctccatctacctggagtccgtggctatccttccgcagctatttatgatcagcaag
actggggaggccgagaccatcaccacccactacctgttcttcctgggcctctatcgtgct
ttgtatcttgtcaactggatctggcgcttctactttgagggcttctttgacctcattgct
gtggtggccggcgtagtccagaccatcctatactgtgacttcttctacttgtacattaca
aaagtactcaagggaaagaagctcagtttgccagcataa

DBGET integrated database retrieval system