KEGG   Homo sapiens (human): 11015
Entry
11015             CDS       T01001                                 

Gene name
KDELR3, ERD2L3
Definition
(RefSeq) KDEL endoplasmic reticulum protein retention receptor 3
  KO
K10949  ER lumen protein retaining receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    11015 (KDELR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11015 (KDELR3)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    11015 (KDELR3)
SSDB
Motif
Pfam: ER_lumen_recept PQ-loop
Other DBs
NCBI-GeneID: 11015
NCBI-ProteinID: NP_006846
HGNC: 6306
Ensembl: ENSG00000100196
Vega: OTTHUMG00000153520
Pharos: O43731(Tdark)
UniProt: O43731 A0A024R1R0
Position
22q13.1
AA seq 214 aa
MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLDLFTNFISIYN
TVMKVVFLLCAYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW
TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLANWIRRYQTENFYDQIA
VVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPMPI
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaacgtgttccgaatcctcggcgacctgagccacctcctggccatgatcttgctgctg
gggaagatctggaggtccaagtgctgcaagggcatctctgggaagagccagatcctgttt
gctctcgtcttcaccaccaggtacctggacctgttcaccaacttcatctccatctacaac
acagtaatgaaggtggtttttctcctctgtgcctatgttacagtgtacatgatatatggg
aaattccgtaaaacttttgacagtgagaatgacacattccgcctggagtttcttctggtc
ccagtcattggcctttccttccttgaaaactacagtttcactctgctggagatcctctgg
actttctctatctatctggaatcagtggctatcctgccccagctcttcatgatcagcaag
actggagaggctgagaccataactactcactacctgttctttctgggtctgtaccgggca
ctctacctggctaactggatcaggcggtaccagactgagaatttctatgaccaaattgca
gtcgtgtctggagtagtacaaaccatcttctactgtgacttcttctacttgtatgtgacc
aaagtccttaagggaaagaagttaagtcttccaatgccaatctga

DBGET integrated database retrieval system