KEGG   Homo sapiens (human): 11017
Entry
11017             CDS       T01001                                 
Symbol
SNRNP27, 27K, RY1
Name
(RefSeq) small nuclear ribonucleoprotein U4/U6.U5 subunit 27
  KO
K12846  U4/U6.U5 tri-snRNP-associated protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    11017 (SNRNP27)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    11017 (SNRNP27)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP specific factors
    11017 (SNRNP27)
SSDB
Motif
Pfam: SNRNP27 DUF2457 Hamartin
Other DBs
NCBI-GeneID: 11017
NCBI-ProteinID: NP_006848
OMIM: 619629
HGNC: 30240
Ensembl: ENSG00000124380
Pharos: Q8WVK2(Tdark)
UniProt: Q8WVK2 A8K513
Structure
Position
2:69893956..69905236
AA seq 155 aa
MGRSRSRSPRRERRRSRSTSRERERRRRERSRSRERDRRRSRSRSPHRRRSRSPRRHRST
SPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKV
DGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA
NT seq 468 nt   +upstreamnt  +downstreamnt
atgggtcgcagtcgcagccgctctccacggagggaacgtaggcgttcccggtccacatcc
cgggagagagaacgcaggcgccgagaaaggtccaggtctcgggagagagatcggagaagg
agccgctcgcgatccccgcaccgaagacgctcccgatctccaagacgacatagatccaca
tctccttccccttctcgactgaaagaaagaagagatgaggaaaagaaagaaacaaaagaa
acaaagagcaaagaacggcagattactgaggaagacttagagggcaaaacagaggaagaa
atagaaatgatgaagttaatgggatttgcctcctttgactccacaaaaggtaagaaggtg
gatggctctgtaaatgcctatgccataaatgtctctcagaagaggaagtacaggcagtac
atgaatcgaaaaggtggattcaacagacctttggatttcattgcatga

DBGET integrated database retrieval system