KEGG   Homo sapiens (human): 11025
Entry
11025             CDS       T01001                                 

Symbol
LILRB3, CD85A, HL9, ILT-5, ILT5, LILRA6, LIR-3, LIR3, PIR-B, PIRB
Name
(RefSeq) leukocyte immunoglobulin like receptor B3
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    11025 (LILRB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    11025 (LILRB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    11025 (LILRB3)
CD molecules [BR:hsa04090]
 Proteins
  11025 (LILRB3)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 11025
NCBI-ProteinID: NP_001074919
OMIM: 604820
HGNC: 6607
Ensembl: ENSG00000204577
Vega: OTTHUMG00000066626
Position
19q13.42
AA seq 632 aa
MTPALTALLCLGLSLGPRTRMQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQL
DKEGSPEPWDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGF
YNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQAL
FPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQS
LTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSYGGQYRCYGAH
NLSSEWSAPSDPLDILITGQIYDTVSLSAQPGPTVASGENMTLLCQSRGYFDTFLLTKEG
AAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPHLLSFPSEPLELMVSG
HSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLLRQRHSKHRTSDQRKT
DFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQQSPHDEDPQ
AVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLH
SLTLRRKATEPPPSQEGEPPAEPSIYATLAIH
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgacgcccgccctcacagccctgctctgccttgggctgagtctgggccccaggacccgc
atgcaggcagggcccttccccaaacccaccctctgggctgagccaggctctgtgatcagc
tgggggagccccgtgaccatctggtgtcaggggagcctggaggcccaggagtaccaactg
gataaagagggaagcccagagccctgggacagaaataacccactggaacccaagaacaag
gccagattctccatcccatccatgacacagcaccatgcagggagataccgctgccactat
tacagctctgcaggctggtcagagcccagcgaccccctggagctggtgatgacaggattc
tacaacaaacccaccctctcagccctgcccagccctgtggtggcctcaggggggaatatg
accctccgatgtggctcacagaagggatatcaccattttgttctgatgaaggaaggagaa
caccagctcccccggaccctggactcacagcagctccacagtggggggttccaggccctg
ttccctgtgggccccgtgacccccagccacaggtggaggttcacatgctattactattat
acaaacaccccctgggtgtggtcccaccccagtgaccccctggagattctgccctcaggc
gtgtctaggaagccctccctcctgaccctgcagggccctgtcctggcccctgggcagagc
ctgaccctccagtgtggctctgatgtcggctacgacagatttgttctgtataaggagggg
gaacgtgacttcctccagcgccctggccagcagccccaggctgggctctcccaggccaac
ttcaccctgggccctgtgagccgctcctacgggggccagtacaggtgctatggtgcacac
aacctctcctccgagtggtcggcccccagtgaccccctggacatcctgatcacaggacag
atctatgacaccgtctccctgtcagcacagccgggccccacagtggcctcaggagagaac
atgaccctgctgtgtcagtcacgggggtattttgacactttccttctgaccaaagaaggg
gcagcccatcccccactgcgtctgagatcaatgtacggagctcataagtaccaggctgaa
ttccccatgagtcctgtgacctcagcccacgcggggacctacaggtgctacggctcacgc
agctccaacccccacctgctgtctttccccagtgagcccctggaactcatggtctcagga
cactctggaggctccagcctcccacccacagggccgccctccacacctggtctgggaaga
tacctggaggttttgattggggtctcggtggccttcgtcctgctgctcttcctcctcctc
ttcctcctcctcctccgtcagcgtcacagcaaacacaggacatctgaccagagaaagact
gatttccagcgtcctgcaggggctgcggagacagagcccaaggacaggggcctgctgagg
aggtccagcccagctgctgacgtccaggaagaaaacctctatgctgctgtgaaggacaca
cagtctgaggacagggtggagctggacagtcagcagagcccacacgatgaagacccccag
gcagtgacgtatgccccggtgaaacactccagtcctaggagagaaatggcctctcctccc
tcctcactgtctggggaattcctggacacaaaggacagacaggtggaagaggacaggcag
atggacactgaggctgctgcatctgaagcctcccaggatgtgacctacgcccagctgcac
agcttgacccttagacggaaggcaactgagcctcctccatcccaggaaggggaacctcca
gctgagcccagcatctacgccactctggccatccactag

DBGET integrated database retrieval system