KEGG   Homo sapiens (human): 11026Help
Entry
11026             CDS       T01001                                 

Gene name
LILRA3, CD85E, HM31, HM43, ILT-6, ILT6, LIR-4, LIR4
Definition
(RefSeq) leukocyte immunoglobulin like receptor A3
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    11026 (LILRA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    11026 (LILRA3)
CD molecules [BR:hsa04090]
 Proteins
  11026 (LILRA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig
Motif
Other DBs
NCBI-GeneID: 11026
NCBI-ProteinID: NP_006856
OMIM: 604818
HGNC: 6604
Pharos: Q8N6C8(Tbio)
UniProt: Q8N6C8
Structure
PDB: 

Position
19q13.4
AA seq 439 aa AA seqDB search
MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHL
YREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTG
AYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRA
IFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGE
KLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGA
YNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKE
GAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS
GAAETLSPPQNKSDSKAGE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacccccatcctcacggtcctgatctgtctcgggctgagcctggaccccaggacccac
gtgcaggcagggcccctccccaagcccaccctctgggctgagccaggctctgtgatcacc
caagggagtcctgtgaccctcaggtgtcaggggagcctggagacgcaggagtaccatcta
tatagagaaaagaaaacagcactctggattacacggatcccacaggagcttgtgaagaag
ggccagttccccatcctatccatcacctgggaacatgcagggcggtattgctgtatctat
ggcagccacactgcaggcctctcagagagcagtgaccccctggagctggtggtgacagga
gcctacagcaaacccaccctctcagctctgcccagccctgtggtgacctcaggagggaat
gtgaccatccagtgtgactcacaggtggcatttgatggcttcattctgtgtaaggaagga
gaagatgaacacccacaatgcctgaactcccattcccatgcccgtgggtcatcccgggcc
atcttctccgtgggccccgtgagcccaagtcgcaggtggtcgtacaggtgctatggttat
gactcgcgcgctccctatgtgtggtctctacccagtgatctcctggggctcctggtccca
ggtgtttctaagaagccatcactctcagtgcagccgggtcctgtcgtggcccctggggag
aagctgaccttccagtgtggctctgatgccggctacgacagatttgttctgtacaaggag
tggggacgtgacttcctccagcgccctggccggcagccccaggctgggctctcccaggcc
aacttcaccctgggccctgtgagccgctcctacgggggccagtacacatgctccggtgca
tacaacctctcctccgagtggtcggcccccagcgaccccctggacatcctgatcacagga
cagatccgtgccagacccttcctctccgtgcggccgggccccacagtggcctcaggagag
aacgtgaccctgctgtgtcagtcacagggagggatgcacactttccttttgaccaaggag
ggggcagctgattccccgctgcgtctaaaatcaaagcgccaatctcataagtaccaggct
gaattccccatgagtcctgtgacctcggcccacgcggggacctacaggtgctacggctca
ctcagctccaacccctacctgctgactcaccccagtgaccccctggagctcgtggtctca
ggagcagctgagaccctcagcccaccacaaaacaagtccgactccaaggctggtgagtga

DBGET integrated database retrieval system