KEGG   Homo sapiens (human): 11030Help
Entry
11030             CDS       T01001                                 

Gene name
RBPMS, HERMES
Definition
(RefSeq) RNA binding protein, mRNA processing factor
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1
Motif
Other DBs
NCBI-GeneID: 11030
NCBI-ProteinID: NP_001008710
OMIM: 601558
HGNC: 19097
Ensembl: ENSG00000157110
Vega: OTTHUMG00000163845
Pharos: Q93062(Tbio)
UniProt: Q93062
Structure
PDB: 

Position
8p12
AA seq 196 aa AA seqDB search
MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK
QPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPL
PNTVPQFIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWL
PPSEATSQGWKSRQFC
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacggcggcaaagccgagaaggagaacaccccgagcgaggccaaccttcaggag
gaggaggtccggaccctatttgtcagtggccttcctctggatatcaaacctcgggagctc
tatctgcttttcagaccatttaagggctatgagggttctcttataaagctcacatctaaa
cagcctgtaggttttgtcagttttgacagtcgctcagaagcagaggctgcaaagaatgct
ttgaatggcatccgcttcgatcctgaaattccgcaaacactacgactagagtttgctaag
gcaaacacgaagatggccaagaacaaactcgtagggactccaaaccccagtactcctctg
cccaacactgtacctcagttcattgccagagagccatatgagctcacagtgcctgcactt
taccccagtagccctgaagtgtgggccccgtaccctctgtacccagcggagttagcgcct
gctctacctcctcctgctttcacctatcccgcttcactgcatgcccagatgcgctggctc
cctccctccgaggctacttctcagggctggaagtcccgtcagttctgctga

DBGET integrated database retrieval system