KEGG   Homo sapiens (human): 11031
Entry
11031             CDS       T01001                                 

Gene name
RAB31, Rab22B
Definition
(RefSeq) RAB31, member RAS oncogene family
  KO
K07891  Ras-related protein Rab-22
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11031 (RAB31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11031 (RAB31)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    11031 (RAB31)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    11031 (RAB31)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    11031 (RAB31)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 GTP_EFTU Gtr1_RagA TniB FeoB_N AAA_7 AAA_5 NACHT AAA_16
Other DBs
NCBI-GeneID: 11031
NCBI-ProteinID: NP_006859
OMIM: 605694
HGNC: 9771
Ensembl: ENSG00000168461
Vega: OTTHUMG00000178513
Pharos: Q13636(Tbio)
UniProt: Q13636
Structure
PDB: 
2FG5

Position
18p11.22
AA seq 195 aa
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIW
DTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNK
CDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGT
IKVEKPTMQASRRCC
NT seq 588 nt   +upstreamnt  +downstreamnt
atgatggcgatacgggagctcaaagtgtgccttctcggggacactggggttgggaaatca
agcatcgtgtgtcgatttgtccaggatcactttgaccacaacatcagccctactattggg
gcatcttttatgaccaaaactgtgccttgtggaaatgaacttcacaagttcctcatctgg
gacactgctggtcaggaacggtttcattcattggctcccatgtactatcgaggctcagct
gcagctgttatcgtgtatgatattaccaagcaggattcattttataccttgaagaaatgg
gtcaaggagctgaaagaacatggtccagaaaacattgtaatggccatcgctggaaacaag
tgcgacctctcagatattagggaggttcccctgaaggatgctaaggaatacgctgaatcc
ataggtgccatcgtggttgagacaagtgcaaaaaatgctattaatatcgaagagctcttt
caaggaatcagccgccagatcccacccttggacccccatgaaaatggaaacaatggaaca
atcaaagttgagaagccaaccatgcaagccagccgccggtgctgttga

DBGET integrated database retrieval system