KEGG   Homo sapiens (human): 11033
Entry
11033             CDS       T01001                                 

Gene name
ADAP1, CENTA1, GCS1L, p42IP4
Definition
(RefSeq) ArfGAP with dual PH domains 1
  KO
K23781  Arf-GAP with dual PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    11033 (ADAP1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   11033 (ADAP1)
SSDB
Motif
Pfam: ArfGap PH PH_11 PH_8 PH_3
Other DBs
NCBI-GeneID: 11033
NCBI-ProteinID: NP_006860
OMIM: 608114
HGNC: 16486
Ensembl: ENSG00000105963
Vega: OTTHUMG00000023380
Pharos: O75689(Tbio)
UniProt: O75689
Structure
PDB: 
3LJU 3FEH 3FM8 3MDB

Position
7p22.3
AA seq 374 aa
MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSV
RLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIY
PEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMKIEHL
NATFQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGA
GDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIG
SKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPML
PQEYAVEAHFKHKP
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggccaaggagcggcgcagggcggtcctggagctgctgcagcggccggggaacgcgcgc
tgcgcggactgcggcgccccggatcccgactgggcctcctacactctgggcgtcttcatc
tgcctgagctgctcgggaatccaccggaatatcccccaggtcagcaaggtgaagtccgtc
cgcctggacgcctgggaggaggcccaagtggagttcatggcctcccacgggaacgacgcc
gcgagagccaggtttgagtccaaagtaccctccttctactaccggcccacgccctccgac
tgccagctccttcgagagcagtggatccgggccaagtacgagcgacaggagttcatctac
ccggagaagcaggagccctactcggcagggtaccgtgagggttttctctggaagcgtggc
cgggacaacgggcagtttttgagccggaagtttgtgctgacagaacgagagggtgctctg
aagtatttcaacagaaatgatgccaaggagcccaaggccgtgatgaagatcgagcacctg
aacgccaccttccagccggccaagatcggccacccccacggcctgcaggtcacctacctg
aaggacaacagcacccgtaacatcttcatctaccatgaggacgggaaggagattgtggac
tggttcaatgcactccgagctgctcgcttccactacctgcaggtggcattcccaggggcc
ggcgacgcagatctggtgccaaagctctccaggaactacctgaaggaaggctacatggag
aagacggggcccaagcaaacggaaggcttccggaagcgctggttcaccatggatgaccgc
aggctcatgtacttcaaagaccccctggacgccttcgcccgaggggaagtcttcattggc
agcaaggagagtggctacacggtgctgcatgggttcccgccgtccacccagggccaccac
tggccacatggcatcaccatcgtcacgcccgaccgcaagtttctgtttgcctgcgagacg
gagtccgaccagagggagtgggtggcggccttccagaaggcggtggacaggcccatgctg
ccccaggagtacgcagtggaggcgcacttcaagcataaaccttag

DBGET integrated database retrieval system