KEGG   Homo sapiens (human): 11034
Entry
11034             CDS       T01001                                 

Gene name
DSTN, ACTDP, ADF, HEL32, bA462D18.2
Definition
(RefSeq) destrin, actin depolymerizing factor
  KO
K10363  destrin (actin-depolymerizing factor)
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    11034 (DSTN)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     11034 (DSTN)
SSDB
Motif
Pfam: Cofilin_ADF
Other DBs
NCBI-GeneID: 11034
NCBI-ProteinID: NP_006861
OMIM: 609114
HGNC: 15750
Ensembl: ENSG00000125868
Vega: OTTHUMG00000031947
Pharos: P60981(Tbio)
UniProt: P60981 V9HWA6
Position
20p12.1
AA seq 165 aa
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDV
GVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASS
KDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcctcaggagtgcaagtagctgatgaagtatgtcgcattttttatgacatgaaagtt
cgtaaatgctccacaccagaagaaatcaagaaaagaaagaaggctgtcattttttgtctc
agtgcagacaaaaagtgcatcattgtagaagaaggcaaagagatcttggttggagatgtt
ggtgtaaccataactgatcctttcaagcattttgtgggaatgcttcctgaaaaagattgt
cgctatgctttgtatgatgcaagctttgaaacaaaagaatccagaaaagaagagttgatg
ttttttttgtgggcaccagaactagcacctctgaaaagtaaaatgatctatgcaagctcc
aaggatgcaattaaaaagaaatttcaaggcataaaacatgaatgtcaagcaaatggacca
gaagatctcaatcgggcttgtattgctgaaaagttaggtggatccttaattgtagccttt
gaaggatgccctgtgtag

DBGET integrated database retrieval system