KEGG   Homo sapiens (human): 11035Help
Entry
11035             CDS       T01001                                 

Gene name
RIPK3, RIP3
Definition
(RefSeq) receptor interacting serine/threonine kinase 3
  KO
K08847  receptor-interacting serine/threonine-protein kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    11035 (RIPK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    11035 (RIPK3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11035 (RIPK3)
   04623 Cytosolic DNA-sensing pathway
    11035 (RIPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    11035 (RIPK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11035 (RIPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   11035 (RIPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RHIM APH Haspin_kinase TrbM
Motif
Other DBs
NCBI-GeneID: 11035
NCBI-ProteinID: NP_006862
OMIM: 605817
HGNC: 10021
Ensembl: ENSG00000129465
Vega: OTTHUMG00000029349
Pharos: Q9Y572(Tbio)
UniProt: Q9Y572
Position
14q12
AA seq 518 aa AA seqDB search
MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISRE
VKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRL
LKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPG
GTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRP
SLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSS
VPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLA
PSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcgtcaagttatggcccagcggtgcccccgcccccttggtgtccatcgaggaa
ctggagaaccaggagctcgtcggcaaaggcgggttcggcacagtgttccgggcgcaacat
aggaagtggggctacgatgtggcggtcaagatcgtaaactcgaaggcgatatccagggag
gtcaaggccatggcaagtctggataacgaattcgtgctgcgcctagaaggggttatcgag
aaggtgaactgggaccaagatcccaagccggctctggtgactaaattcatggagaacggc
tccttgtcggggctgctgcagtcccagtgccctcggccctggccgctcctttgccgcctg
ctgaaagaagtggtgcttgggatgttttacctgcacgaccagaacccggtgctcctgcac
cgggacctcaagccatccaacgtcctgctggacccagagctgcacgtcaagctggcagat
tttggcctgtccacatttcagggaggctcacagtcagggacagggtccggggagccaggg
ggcaccctgggctacttggccccagaactgtttgttaacgtaaaccggaaggcctccaca
gccagtgacgtctacagcttcgggatcctaatgtgggcagtgcttgctggaagagaagtt
gagttgccaaccgaaccatcactcgtgtacgaagcagtgtgcaacaggcagaaccggcct
tcattggctgagctgccccaagccgggcctgagactcccggcttagaaggactgaaggag
ctaatgcagctctgctggagcagtgagcccaaggacagaccctccttccaggaatgccta
ccaaaaactgatgaagtcttccagatggtggagaacaatatgaatgctgctgtctccacg
gtaaaggatttcctgtctcagctcaggagcagcaataggagattttctatcccagagtca
ggccaaggagggacagaaatggatggctttaggagaaccatagaaaaccagcactctcgt
aatgatgtcatggtttctgagtggctaaacaaactgaatctagaggagcctcccagctct
gttcctaaaaaatgcccgagccttaccaagaggagcagggcacaagaggagcaggttcca
caagcctggacagcaggcacatcttcagattcgatggcccaacctccccagactccagag
acctcaactttcagaaaccagatgcccagccctacctcaactggaacaccaagtcctgga
ccccgagggaatcagggggctgagagacaaggcatgaactggtcctgcaggaccccggag
ccaaatccagtaacagggcgaccgctcgttaacatatacaactgctctggggtgcaagtt
ggagacaacaactacttgactatgcaacagacaactgccttgcccacatggggcttggca
ccttcgggcaaggggaggggcttgcagcaccccccaccagtaggttcgcaagaaggccct
aaagatcctgaagcctggagcaggccacagggttggtataatcatagcgggaaataa

DBGET integrated database retrieval system