KEGG   Homo sapiens (human): 11037Help
Entry
11037             CDS       T01001                                 

Gene name
STON1, SALF, SBLF, STN1, STNB1
Definition
(RefSeq) stonin 1
  KO
K20067  stonin-1/2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11037 (STON1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    11037 (STON1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adap_comp_sub
Motif
Other DBs
NCBI-GeneID: 11037
NCBI-ProteinID: NP_001185524
OMIM: 605357
HGNC: 17003
Ensembl: ENSG00000243244
Vega: OTTHUMG00000129169
UniProt: Q9Y6Q2
Position
2p16.3
AA seq 735 aa AA seqDB search
MCSTNPGKWVTFDDDPAVQSSQKSKNFPLENQGVCRPNGLKLNLPGLREFPSGSSSTSST
PLSSPIVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPESSSDSPLAISGGE
SSLLPTRPTCLSHALLPSDHSCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDC
AFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMPIDQKSLNKCSLNYICEKLEHLQSAE
NQDSLRSLSMHCLCAEENASSFVPHTLFRSQPKSGWSFMLRIPEKKNMMSSRQWGPIFLK
VLPGGILQMYYEQGLEKPFKEIQLDPYCRLSEPKVENFSVAGKIHTVKIEHVSYTEKRKY
HSKTEVVHEPDIEQMLKLGSTSYHDFLDFLTTVEEELMKLPAVSKPKKNYEEQEISLEIV
DNFWGKVTKEGKFVESAVITQIYCLCFVNGNLECFLTLNDLELPKRDESYYEKDSEKKGI
DILDYHFHKCVNVQEFEQSRIIKFVPLDACRFELMRFKTLYNGDNLPFSLKSVVVVQGAY
VELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRR
ACLGSLQELESEPVIQVTVGSAKYESAYQAVVWKIDRLPDKNSSLDHPHCLSYKLELGSD
QEIPSDWYPFATVQFSVPDTCASRTEVRSLGVESDVQPQKHVQQRACYNIQVEIEKKWIK
IDGEDPDKIGDCITQ
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccacaaatccaggcaaatgggtcacctttgatgatgatcctgctgttcaatct
tctcaaaagtcaaagaattttcctctggagaatcaaggtgtctgtagaccaaatggactg
aagctgaaccttcctggcctcagggaatttcccagtggatcttcctccaccagcagcact
cctctctcctcccccattgtagatttttatttcagtccaggacctccaagtaactctcct
ctttctacacctaccaaagacttcccaggttttcctggcatccccaaagcagggactcat
gtgctttatcctattccagaatcatcttcagacagcccactcgcaatatcaggaggagaa
tcttccttactgcctaccagaccaacatgtttatcccatgccttgttacccagtgaccac
tcatgtacacatccaactcccaaagtaggtcttccagatgaagttaatcctcaacaggct
gaaagcctaggattccaaagtgatgatctcccccagtttcagtattttcgagaggactgt
gctttttcaagtccattttggaaagatgaaggcagtgattcccatttcacccttgaccca
ccaggaagcaaaaagatgttctcatcaagaaacaaggagatgcctattgaccaaaaaagc
ctaaataagtgttcactcaactatatctgtgagaagcttgaacatctccagtcagctgag
aaccaagactcacttagaagtttgtctatgcactgtctatgtgctgaagaaaatgcctct
tcctttgtcccccacacactcttcaggagtcagccaaaatccggatggtctttcatgctg
agaattcctgagaagaagaatatgatgtcttcccggcaatggggaccaatttttctgaaa
gttttgcctggaggaattttgcagatgtattatgaacagggattagaaaaaccatttaaa
gagatacagcttgatccatattgtaggctttctgaacccaaggttgagaacttcagtgta
gcaggaaaaatccacactgtgaagattgaacatgtgtcttacacagaaaaaaggaaatac
cattctaagacagaagtagttcatgaacctgacatagagcagatgctgaagttggggtcc
acatcgtaccatgacttccttgactttctgactactgtggaggaggagctgatgaagttg
ccagctgtttcaaaaccaaaaaagaactacgaggagcaagaaatttccttggaaattgtg
gacaacttttggggtaaagtcacaaaagaaggaaaatttgttgaaagtgctgtgataact
caaatttattgcctctgctttgtgaatgggaacctggaatgctttttaaccttgaatgac
cttgagttgccgaagcgagatgaatcctattatgagaaggactcagaaaaaaaggggatt
gatattcttgactaccattttcataagtgtgtgaatgtacaagaatttgagcaatcaaga
atcattaagtttgtacctctggatgcctgccggtttgagctgatgcgtttcaagactttg
tataatggggataatcttcccttttccttgaagtctgtagtggttgtccagggagcatac
gtggaacttcaggcttttgtcaacatggcctcattggcgcagaggtcatcctatgctggt
tccttaaggtcctgtgacaatataaggatacactttcctgtcccatcgcagtggatcaag
gccctttggaccatgaacctccagaggcagaagtctctgaaagctaaaatgaaccgccga
gcatgtctggggagtttacaggaacttgaatctgaacctgtcattcaagtcactgtgggg
tcagcaaaatatgagagtgcctaccaggcagtggtatggaagatagatcggcttccagac
aaaaattcaagtctagatcatccccattgtctgtcatacaaattagagcttggatcagac
caagaaattccctctgattggtatccatttgctactgttcagttttccgtgcctgacacc
tgtgcctcaaggacagaggtcaggtctctgggagtggagagtgatgtccagccacagaaa
catgttcagcagcgagcttgctacaacatccaggttgaaatagaaaagaagtggattaaa
atcgatggagaagacccagataaaattggtgactgcataactcagtag

DBGET integrated database retrieval system