KEGG   Homo sapiens (human): 1104
Entry
1104              CDS       T01001                                 

Gene name
RCC1, CHC1, RCC1-I, SNHG3-RCC1
Definition
(RefSeq) regulator of chromosome condensation 1
  KO
K11493  regulator of chromosome condensation
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1104 (RCC1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    1104 (RCC1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     1104 (RCC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    1104 (RCC1)
SSDB
Motif
Pfam: RCC1 RCC1_2 DUF4716
Other DBs
NCBI-GeneID: 1104
NCBI-ProteinID: NP_001041664
OMIM: 179710
HGNC: 1913
Ensembl: ENSG00000180198
Vega: OTTHUMG00000003645
Pharos: P18754(Tbio)
UniProt: P18754 Q5T081
Structure
PDB: 
1A12 1I2M 5TBK

Position
1p35.3
AA seq 421 aa
MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKP
ALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEK
VVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASG
NDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHV
RFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFS
GGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAV
TKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQ
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtcacccaagcgcatagctaaaagaaggtcccccccagcagatgccatccccaaaagc
aagaaggtgaaggtctcacacaggtcccacagcacagaacccggcttggtgctgacacta
ggccagggcgacgtgggccagctggggctgggtgagaatgtgatggagaggaagaagccg
gccctggtatccattccggaggatgttgtgcaggctgaggctgggggcatgcacaccgtg
tgtctaagcaaaagtggccaggtctattccttcggctgcaatgatgagggtgccctggga
agggacacatcagtggagggctcggagatggtccctgggaaagtggagctgcaagagaag
gtggtacaggtgtcagcaggagacagtcacacagcagccctcaccgatgatggccgtgtc
ttcctctggggctccttccgggacaataacggtgtgattggactgttggagcccatgaag
aagagcatggtgcctgtgcaggtgcagctggatgtgcctgtggtaaaggtggcctcagga
aacgaccacttggtgatgctgacagctgatggtgacctctacaccttgggctgcggggaa
cagggccagctaggccgtgtgcctgagttatttgccaaccgtggtggccggcaaggcctc
gaacgactcctggtccccaagtgtgtgatgctgaaatccaggggaagccggggccacgtg
agattccaggatgccttttgtggtgcctatttcacctttgccatctcccatgagggccac
gtgtacggcttcggcctctccaactaccatcagcttggaactccgggcacagaatcttgc
ttcataccccagaacctaacatccttcaagaattccaccaagtcctgggtgggcttctct
ggtggccagcaccatacagtctgcatggattcggaaggaaaagcatacagcctgggccgg
gctgagtatgggcggctgggccttggagagggtgctgaggagaagagcatacccaccctc
atctccaggctgcctgctgtctcctcggtggcttgtggggcctctgtggggtatgctgtg
accaaggatggtcgtgttttcgcctggggcatgggcaccaactaccagctgggcacaggg
caggatgaggacgcctggagccctgtggagatgatgggcaaacagctggagaaccgtgtg
gtcttatctgtgtccagcgggggccagcatacagtcttattagtcaaggacaaagaacag
agctga

DBGET integrated database retrieval system