KEGG   Homo sapiens (human): 11046Help
Entry
11046             CDS       T01001                                 

Gene name
SLC35D2, HFRC1, SQV7L, UGTrel8, hfrc
Definition
(RefSeq) solute carrier family 35 member D2
  KO
K15281  solute carrier family 35
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    11046 (SLC35D2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC35: Nucleoside-sugar transporter
   11046 (SLC35D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPT UAA CRT-like
Motif
Other DBs
NCBI-GeneID: 11046
NCBI-ProteinID: NP_008932
OMIM: 609182
HGNC: 20799
Ensembl: ENSG00000130958 ENSG00000285269
Vega: OTTHUMG00000020293
Pharos: Q76EJ3(Tdark)
UniProt: Q76EJ3 A0A024R9N5
Position
9q22.32
AA seq 337 aa AA seqDB search
MTAGGQAEAEGAGGEPGAARLPSRVARLLSALFYGTCSFLIVLVNKALLTTYGFPSPIFL
GIGQMAATIMILYVSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMF
TVLRKFTIPLTLLLETIILGKQYSLNIILSVFAIILGAFIAAGSDLAFNLEGYIFVFLND
IFTAANGVYTKQKMDPKELGKYGVLFYNACFMIIPTLIISVSTGDLQQATEFNQWKNVVF
ILQFLLSCFLGFLLMYSTVLCSYYNSALTTAVVGAIKNVSVAYIGILIGGDYIFSLLNFV
GLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacggccggcggccaggccgaggccgagggcgctggcggggagcccggcgcggcgcgg
ctgccctcgcgggtggcccggctgctgtcggcgctcttctacgggacctgctccttcctc
atcgtgcttgtcaacaaggcgctgctgaccacctacggtttcccgtcaccaattttcctt
ggaattggacagatggcagccaccataatgatactatatgtgtccaagctaaacaaaatc
attcacttccctgattttgataagaaaattcctgtaaagctgtttcctctgcctctcctc
tacgttggaaaccacataagtggattatcaagcacaagtaaattaagcctaccgatgttc
accgtgctcaggaaattcaccattccacttaccttacttctggaaaccatcatacttggg
aagcagtattcactcaacatcatcctcagtgtctttgccattattctcggggctttcata
gcagctgggtctgaccttgcttttaacttagaaggctatatttttgtattcctgaatgat
atcttcacagcagcaaatggagtttataccaaacagaaaatggacccaaaggagctaggg
aaatacggagtacttttctacaatgcctgcttcatgattatcccaactcttattattagt
gtctccactggagacctgcaacaggctactgaattcaaccaatggaagaatgttgtgttt
atcctacagtttcttctttcctgttttttggggtttctgctgatgtactccacggttctg
tgcagctattacaattcagccctgacgacagcagtggttggagccatcaagaatgtatcc
gttgcctacattgggatattaatcggtggagactacattttctctttgttaaactttgta
gggttaaatatttgcatggcagggggcttgagatattcctttttaacactgagcagccag
ttaaaacctaaacctgtgggtgaagaaaacatctgtttggatttgaagagctaa

DBGET integrated database retrieval system