KEGG   Homo sapiens (human): 11047Help
Entry
11047             CDS       T01001                                 

Gene name
ADRM1, ARM-1, ARM1, GP110
Definition
(RefSeq) adhesion regulating molecule 1
  KO
K06691  26S proteasome regulatory subunit N13
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Module
hsa_M00341  Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    11047 (ADRM1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    11047 (ADRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    11047 (ADRM1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     11047 (ADRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPN13_C Proteasom_Rpn13 ASXH GerD DUF1631
Motif
Other DBs
NCBI-GeneID: 11047
NCBI-ProteinID: NP_008933
OMIM: 610650
HGNC: 15759
Ensembl: ENSG00000130706
Vega: OTTHUMG00000032904
Pharos: Q16186(Tbio)
UniProt: Q16186
Structure
PDB: 

Position
20q13.33
AA seq 407 aa AA seqDB search
MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASAT
SPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctcaggcgcgctctttccaagcctggtgccaggctctcggggcgcctccaac
aagtacttggtggagtttcgggcgggaaagatgtccctgaaggggaccaccgtgactccg
gataagcggaaagggctggtgtacattcagcagacggacgactcgcttattcacttctgc
tggaaggacaggacgtccgggaacgtggaagacgacttgatcatcttccctgacgactgt
gagttcaagcgggtgccgcagtgccccagcgggagggtctacgtgctgaagttcaaggca
gggtccaagcggcttttcttctggatgcaggaacccaagacagaccaggatgaggagcat
tgccggaaagtcaacgagtatctgaacaaccccccgatgcctggggcgctgggggccagc
ggaagcagcggccacgaactctctgcgctaggcggtgagggtggcctgcagagcctgctg
ggaaacatgagccacagccagctcatgcagctcatcggaccagccggccttggaggactg
ggtgggctgggggccctgactggacctggcctggccagcttactggggagcagtgggcct
ccagggagcagctcctcctccagctcccggagccagtcggcagcggtcaccccgtcatcc
accacctcttccacccgtgccaccccagccccttctgctccagcagctgcctcagcaact
agcccgagccccgcgcccagttccgggaatggagccagcacagcagccagcccgacccag
cccatccagctgagcgacctccagagcatcctggccacgatgaacgtaccagccgggcca
gcaggcggccagcaagtggacctggccagtgtgctgacgccggagataatggctcccatc
ctcgccaacgcggatgtccaggagcgcctgcttccctacttgccatctggggagtcgctg
ccgcagaccgcggatgagatccagaataccctgacctcgccccagttccagcaggccctg
ggcatgttcagcgcagccttggcctcggggcagctgggccccctcatgtgccagttcggt
ctgcctgcagaggctgtggaggccgccaacaagggcgatgtggaagcgtttgccaaagcc
atgcagaacaacgccaagcccgagcagaaagagggcgacacgaaggacaagaaggacgaa
gaggaggacatgagcctggactga

DBGET integrated database retrieval system