KEGG   Homo sapiens (human): 11047
Entry
11047             CDS       T01001                                 

Gene name
ADRM1, ARM-1, ARM1, GP110, PSMD16
Definition
(RefSeq) ADRM1 26S proteasome ubiquitin receptor
  KO
K06691  26S proteasome regulatory subunit N13
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    11047 (ADRM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    11047 (ADRM1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11047 (ADRM1)
   05012 Parkinson disease
    11047 (ADRM1)
   05014 Amyotrophic lateral sclerosis
    11047 (ADRM1)
   05016 Huntington disease
    11047 (ADRM1)
   05017 Spinocerebellar ataxia
    11047 (ADRM1)
   05020 Prion disease
    11047 (ADRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    11047 (ADRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    11047 (ADRM1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     11047 (ADRM1)
SSDB
Motif
Pfam: RPN13_C Proteasom_Rpn13 ASXH GerD DUF1631
Other DBs
NCBI-GeneID: 11047
NCBI-ProteinID: NP_008933
OMIM: 610650
HGNC: 15759
Ensembl: ENSG00000130706
Vega: OTTHUMG00000032904
Pharos: Q16186(Tbio)
UniProt: Q16186
Structure
PDB: 

Position
20q13.33
AA seq 407 aa
MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASAT
SPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgacgacctcaggcgcgctctttccaagcctggtgccaggctctcggggcgcctccaac
aagtacttggtggagtttcgggcgggaaagatgtccctgaaggggaccaccgtgactccg
gataagcggaaagggctggtgtacattcagcagacggacgactcgcttattcacttctgc
tggaaggacaggacgtccgggaacgtggaagacgacttgatcatcttccctgacgactgt
gagttcaagcgggtgccgcagtgccccagcgggagggtctacgtgctgaagttcaaggca
gggtccaagcggcttttcttctggatgcaggaacccaagacagaccaggatgaggagcat
tgccggaaagtcaacgagtatctgaacaaccccccgatgcctggggcgctgggggccagc
ggaagcagcggccacgaactctctgcgctaggcggtgagggtggcctgcagagcctgctg
ggaaacatgagccacagccagctcatgcagctcatcggaccagccggccttggaggactg
ggtgggctgggggccctgactggacctggcctggccagcttactggggagcagtgggcct
ccagggagcagctcctcctccagctcccggagccagtcggcagcggtcaccccgtcatcc
accacctcttccacccgtgccaccccagccccttctgctccagcagctgcctcagcaact
agcccgagccccgcgcccagttccgggaatggagccagcacagcagccagcccgacccag
cccatccagctgagcgacctccagagcatcctggccacgatgaacgtaccagccgggcca
gcaggcggccagcaagtggacctggccagtgtgctgacgccggagataatggctcccatc
ctcgccaacgcggatgtccaggagcgcctgcttccctacttgccatctggggagtcgctg
ccgcagaccgcggatgagatccagaataccctgacctcgccccagttccagcaggccctg
ggcatgttcagcgcagccttggcctcggggcagctgggccccctcatgtgccagttcggt
ctgcctgcagaggctgtggaggccgccaacaagggcgatgtggaagcgtttgccaaagcc
atgcagaacaacgccaagcccgagcagaaagagggcgacacgaaggacaagaaggacgaa
gaggaggacatgagcctggactga

DBGET integrated database retrieval system