KEGG   Homo sapiens (human): 1105
Entry
1105              CDS       T01001                                 
Symbol
CHD1, CHD-1, PILBOS
Name
(RefSeq) chromodomain helicase DNA binding protein 1
  KO
K11367  chromodomain-helicase-DNA-binding protein 1 [EC:5.6.2.-]
Organism
hsa  Homo sapiens (human)
Disease
H02507  Pilarowski-Bjornsson syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    1105 (CHD1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    1105 (CHD1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     1105 (CHD1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     1105 (CHD1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    SAGA complex
     1105 (CHD1)
    SLIK complex
     1105 (CHD1)
SSDB
Motif
Pfam: SNF2-rel_dom Chromo CDH1_2_SANT_HL1 DUF4208 Helicase_C ResIII
Other DBs
NCBI-GeneID: 1105
NCBI-ProteinID: NP_001261
OMIM: 602118
HGNC: 1915
Ensembl: ENSG00000153922
Pharos: O14646(Tbio)
UniProt: O14646 B3KT33
Structure
Position
5:complement(98853985..98929007)
AA seq 1710 aa
MNGHSDEESVRNSSGESSQSDDDSGSASGSGSGSSSGSSSDGSSSQSGSSDSDSGSESGS
QSESESDTSRENKVQAKPPKVDGAEFWKSSPSILAVQRSAILKKQQQQQQQQQHQASSNS
GSEEDSSSSEDSDDSSSEVKRKKHKDEDWQMSGSGSPSQSGSDSESEEEREKSSCDETES
DYEPKNKVKSRKPQNRSKSKNGKKILGQKKRQIDSSEEDDDEEDYDNDKRSSRRQATVNV
SYKEDEEMKTDSDDLLEVCGEDVPQPEEEEFETIERFMDCRIGRKGATGATTTIYAVEAD
GDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETK
RWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSE
CSWEDGALISKKFQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLE
LRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLS
TLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLKDK
AFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFI
MPEKFSSWEDFEEEHGKGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSA
LQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEAL
QHLIRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKG
ELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHR
IGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPF
NKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLTVGDELLSQFK
VANFSNMDEDDIELEPERNSKNWEEIIPEDQRRRLEEEERQKELEEIYMLPRMRNCAKQI
SFNGSEGRRSRSRRYSGSDSDSISEGKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKK
FGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERTGGRLGKVKGP
TFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSN
LLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLLSRDLAKK
EALSGAGSSKRRKARAKKNKAMKSIKVKEEIKSDSSPLPSEKSDEDDDKLSESKSDGRER
SKKSSVSDAPVHITASGEPVPISEESEELDQKTFSICKERMRPVKAALKQLDRPEKGLSE
REQLEHTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTEFDARKLHKLYKHA
IKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDR
HQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLE
GSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLD
QRSPYGSRSPFEHSVEHKSTPEHTWSSRKT
NT seq 5133 nt   +upstreamnt  +downstreamnt
atgaatggacacagtgatgaagaaagtgttagaaacagtagtggagaatcaagccagtcg
gatgatgattctgggtcagcttcaggctctggatctggttcgagttctggaagcagtagt
gatggaagcagtagccagtcaggtagcagtgactctgactccggatctgaatcaggcagt
cagtcagagtctgagtcagacacttcccgagaaaacaaagttcaagcaaaaccaccgaaa
gttgatggagctgagttttggaaatctagtcctagtattctggccgttcagagatctgca
atcctcaagaagcagcaacagcagcagcagcaacaacaacatcaagcctcatctaatagc
ggatcagaagaggattcctctagcagtgaagattccgatgactcatcaagtgaggtcaaa
aggaaaaagcataaagatgaagattggcaaatgtctgggtcaggatctccatctcagtct
ggttcagattcagaatctgaagaagagagagagaaaagcagttgtgatgaaacagaatct
gattatgagccaaaaaacaaagtcaaaagcagaaaacctcaaaatagatctaagtcaaaa
aatggaaagaagattcttggacaaaaaaagagacagattgattcatctgaggaggatgat
gatgaagaagattatgataatgataaaagaagttctcgtcgccaagcaactgttaatgtt
agctataaggaggatgaagaaatgaaaacagattctgatgacctactggaagtctgtgga
gaggatgttcctcaacctgaggaagaggaatttgaaaccatagaaagatttatggattgt
cggattgggagaaaaggagctactggtgctactacaaccatctatgcagttgaagcagat
ggtgacccaaatgcaggctttgaaaaaaacaaagaaccaggagagattcagtatttaatt
aaatggaaaggatggtcccatatccacaacacttgggagacagaagaaaccctcaagcag
cagaatgttagaggaatgaaaaaattggataattataagaaaaaagatcaggaaacaaaa
agatggttgaaaaatgcctctccagaagatgtggaatattataattgccagcaagaactt
acagatgatctacataaacagtatcaaatagtggaacgtataattgctcattccaatcaa
aagtcagcagctggttatcctgattattactgcaaatggcagggccttccatactcagag
tgcagctgggaagatggagctctcatttccaaaaagtttcaagcatgcattgatgagtat
tttagcaggaaccaatcaaaaaccactccttttaaagattgcaaagtattaaaacaaagg
ccaaggtttgtagccctgaagaagcagccatcctatattggaggacatgagggcttagaa
ttaagagattatcaactgaatggtttaaattggcttgctcattcttggtgcaaaggaaat
agttgcatactcgctgatgaaatgggccttggaaaaacaatacagacgatctcatttctg
aattatttgtttcatgaacatcaattatatggaccttttttattggtagtaccgctctcc
actcttacttcctggcaaagggaaattcagacttgggcttctcaaatgaatgctgtggtt
tatttaggtgacattaacagcagaaacatgataagaactcatgaatggacgcatcatcag
accaaacggttaaaatttaatatattgttaacaacttatgaaattttattaaaagataag
gcattccttggaggtctaaattgggcatttataggtgttgatgaagcacaccgattaaag
aatgatgactcccttctgtataaaactttaatagattttaaatccaatcatcgtctcctt
atcactggaactcctctacagaattccctcaaagagctctggtctttgctacatttcatt
atgccagaaaagttttcttcctgggaagattttgaagaagaacatggcaaagggagagaa
tatggttatgcaagccttcacaaggagcttgagccatttctgttacgccgagttaagaaa
gatgtggaaaaatctcttcctgccaaggttgagcagattttaagaatggaaatgagtgct
ttacagaaacaatattacaaatggattttaactaggaattacaaagccctcagcaaaggt
tccaagggcagtacctcaggctttttgaacattatgatggagctaaagaaatgttgtaac
cattgctacctcattaaaccaccagataataatgaattctataataaacaggaggcctta
caacacttaattcgtagtagcggaaaattgattcttcttgacaagctattaattcgccta
agagaacgaggcaatcgagttcttattttttcacaaatggtgcggatgttagatatactt
gcagaatatttgaaatatcgtcaattcccctttcaaagattagatggatcaataaaagga
gaactgaggaaacaagctctagatcattttaatgctgagggatcagaggatttttgcttt
ttgctgtccacaagagctggaggtctagggattaatttagcctctgctgacactgttgtt
atatttgattccgattggaatccacagaatgatcttcaggcacaggctagagcccatcga
attgggcaaaagaaacaggtgaatatttatcgtctagttacaaagggatcagttgaagaa
gatattcttgaaagggcgaaaaagaagatggttttagatcatcttgtaattcaaagaatg
gacacaactgggaagacagtactacatacaggttctgccccatcaagttctactcctttc
aataaagaagagttatcagccattttaaagtttggtgctgaagaactttttaaggaacct
gaaggagaagaacaagagccccaggaaatggatatagatgaaatcttgaagagagctgaa
actcatgaaaatgaaccaggtcctttaactgtaggagatgaattgctttcccagttcaag
gttgccaacttctcaaatatggatgaggatgacattgagttggaacctgaaagaaattca
aagaattgggaggaaattattccagaagatcaaagaagacgattagaagaagaagaaaga
caaaaggaacttgaagaaatttatatgctcccaagaatgagaaattgtgcaaaacagatt
agtttcaatggaagtgaagggaggcgcagtagaagtaggagatactctggatctgatagt
gattccatctcagaagggaaaaggccaaagaaacgtggaagaccacggactattcctcgg
gagaatattaaaggatttagtgatgcagaaattaggcggtttatcaagagctataagaaa
tttggtggtcctctggaaagattagatgcaattgctcgagatgctgagttagttgataag
tcagaaacagaccttagacgactgggagaattggtacataatggttgcattaaagcatta
aaggatagttcttcaggaacagaacgaacaggtggtagactcggaaaagtgaagggtcca
acattccgaatatcaggagtacaggtgaatgccaaactagtcatctcccatgaagaagaa
ttaatacctttgcacaaatccattccttctgatccagaagaaagaaagcagtatactatc
ccatgccacacaaaggcagctcattttgatatagactggggcaaagaagatgattccaat
ttgttaattggcatctatgaatatggatatggaagctgggaaatgattaaaatggatcct
gacctcagtctaacacacaagattcttccagatgatcccgataaaaaaccacaagcaaaa
cagttgcagacccgtgcagactacctcatcaaattacttagtagagatcttgcaaaaaaa
gaagctctttctggtgcgggaagttcaaagaggagaaaagcaagagctaagaagaataaa
gcaatgaagtctataaaagtgaaagaggaaataaagagtgattcttctcctctgccttca
gagaagtctgatgaagatgatgataaattgagtgaatccaagtctgatggtagggaaaga
tccaagaaatcttcagtgtcagatgctccagttcatatcacggcaagtggtgaaccagtt
cccatttctgaagaatctgaagagctggatcagaagacattcagcatttgtaaagaaaga
atgaggcctgttaaagcagctttgaaacaacttgataggcctgagaaaggcctttcagaa
agagaacaactagagcatactagacaatgtttaataaaaattggagaccatatcacagaa
tgtctaaaagagtatacaaatcctgaacaaattaagcaatggagaaaaaacctgtggatt
tttgtatctaagtttactgaatttgatgcaagaaaattacataaattatataagcatgct
attaaaaaacggcaggagtctcagcaaaacagtgatcaaaacagcaacttgaatcctcac
gtgattagaaatccagatgtggaaagattaaaagagaatacaaatcacgatgatagcagc
agggacagttattcctctgatagacacttaactcagtaccatgatcatcataaagaccga
catcagggagattcttacaaaaaaagtgattccaggaaaagaccctattcttcttttagt
aatggtaaagaccatcgtgattgggatcactacaagcaagacagcagatattacagtgac
agagagaaacacagaaaactggatgatcacaggagtagagatcacaggtcaaatttggaa
ggaagtttaaaagatagatctcattctgatcatcgttctcactcagatcatcggttacat
tcagaccaccggtcaagttctgaatatacgcaccataaatcttccagggattataggtat
cactcagactggcaaatggaccacagagcttccagcagtggccctaggtcaccactagat
cagagatctccttatggctccagatctccatttgaacattcagttgaacacaaaagtaca
ccggagcatacctggagtagtcggaaaacataa

DBGET integrated database retrieval system