KEGG   Homo sapiens (human): 11051Help
Entry
11051             CDS       T01001                                 

Gene name
NUDT21, CFIM25, CPSF5
Definition
(RefSeq) nudix hydrolase 21
  KO
K14397  cleavage and polyadenylation specificity factor subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    11051 (NUDT21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    11051 (NUDT21)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     11051 (NUDT21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX_2
Motif
Other DBs
NCBI-GeneID: 11051
NCBI-ProteinID: NP_008937
OMIM: 604978
HGNC: 13870
Ensembl: ENSG00000167005
Vega: OTTHUMG00000133240
Pharos: O43809(Tbio)
UniProt: O43809 A0A024R6W2
Structure
PDB: 

Position
16q13
AA seq 227 aa AA seqDB search
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV
AARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEG
LKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQ
EKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggtaccgcccaatcgctcgcagaccggctggccccggggggtcactcagttc
ggcaacaagtacatccagcagacgaagcccctcaccctggagcgcaccatcaacctgtac
cctcttaccaattatacttttggtacaaaagagcccctctacgagaaggacagctctgtt
gcagccagatttcagcgcatgagggaagaatttgataaaattggaatgaggaggactgta
gaaggggttctgattgtacatgagcaccggctaccccatgtgttactgctgcagctggga
acaactttcttcaaactacctggtggtgaacttaacccaggagaagatgaagttgaagga
ctaaaacgcttaatgacagagatactgggtcgtcaggatggagttttgcaagactgggtc
attgacgattgcattggtaactggtggagaccaaattttgaacctcctcagtatccatat
attcctgcacatattacaaagcctaaggaacataagaagttgtttctggttcagcttcaa
gaaaaagccttgtttgcagtccctaaaaattacaagctggtagctgcaccattgtttgaa
ttgtatgacaatgcaccaggatatggacccatcatttctagtctccctcagctgttgagc
aggttcaattttatttacaactga

DBGET integrated database retrieval system