KEGG   Homo sapiens (human): 11054
Entry
11054             CDS       T01001                                 
Symbol
OGFR
Name
(RefSeq) opioid growth factor receptor
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: OGFr_N OGFr_III
Other DBs
NCBI-GeneID: 11054
NCBI-ProteinID: NP_031372
OMIM: 606459
HGNC: 15768
Ensembl: ENSG00000060491
Pharos: Q9NZT2(Tbio)
UniProt: Q9NZT2
Position
20:62804835..62814000
AA seq 677 aa
MDDPDCDSTWEEDEEDAEDAEDEDCEDGEAAGARDADAGDEDEESEEPRAARPSSFQSRM
TGSRNWRATRDMCRYRHNYPDLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDN
YDLLEDNHSYIQWLFPLREPGVNWHAKPLTLREVEVFKSSQEIQERLVRAYELMLGFYGI
RLEDRGTGTVGRAQNYQKRFQNLNWRSHNNLRITRILKSLGELGLEHFQAPLVRFFLEET
LVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRPRCKFVWGPQDKLRRFKPSSL
PHPLEGSRKVEEEGSPGDPDHEASTQGRTCGPEHSKGGGRVDEGPQPRSVEPQDAGPLER
SQGDEAGGHGEDRPEPLSPKESKKRKLELSRREQPPTEPGPQSASEVEKIALNLEGCALS
QGSLRTGTQEVGGQDPGEAVQPCRQPLGARVADKVRKRRKVDEGAGDSAAVASGGAQTLA
LAGSPAPSGHPKAGHSENGVEEDTEGRTGPKEGTPGSPSETPGPSPAGPAGDEPAESPSE
TPGPRPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAESPSE
TPGPRPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAKAGEA
AELQDAEVESSAKSGKP
NT seq 2034 nt   +upstreamnt  +downstreamnt
atggacgaccccgactgcgactccacctgggaggaggacgaggaggatgcggaggacgcg
gaggacgaggactgcgaggacggcgaggccgccggcgcgagggacgcggacgcaggggac
gaggacgaggagtcggaggagccgcgggcggcgcggcccagctcgttccagtccagaatg
acagggtccagaaactggcgagccacgagggacatgtgtaggtatcggcacaactatccg
gatctggtggaacgagactgcaatggggacacgccaaacctgagtttctacagaaatgag
atccgcttcctgcccaacggctgtttcattgaggacattcttcagaactggacggacaac
tatgacctccttgaggacaatcactcctacatccagtggctgtttcctctgcgagaacca
ggagtgaactggcatgccaagcccctcacgctcagggaggtcgaggtgtttaaaagctcc
caggagatccaggagcggcttgtccgggcctacgagctcatgctgggcttctacgggatc
cggctggaggaccgaggcacgggcacggtgggccgagcacagaactaccagaagcgcttc
cagaacctgaactggcgcagccacaacaacctccgcatcacacgcatcctcaagtcgctg
ggtgagctgggcctcgagcacttccaggcgccgctggtccgcttcttcctggaggagacg
ctggtgcggcgggagctgccgggggtgcggcagagtgccctggactacttcatgttcgcc
gtgcgctgccgacaccagcgccgccagctggtgcacttcgcctgggagcacttccggccc
cgctgcaagttcgtctgggggccccaagacaagctgcggaggttcaagcccagctctctg
ccccatccgctcgagggctccaggaaggtggaggaggaaggaagccccggggaccccgac
cacgaggccagcacccagggtcggacctgtgggccagagcatagcaagggtgggggcagg
gtggacgaggggccccagccacggagcgtggagccccaggatgcgggacccctggagagg
agccagggggatgaggcagggggccacggggaagataggccggagcccttaagccccaaa
gagagcaagaagaggaagctggagctgagccggcgggagcagccgcccacagagccaggc
cctcagagtgcctcagaggtggagaagatcgctctgaatttggaggggtgtgccctcagc
cagggcagcctcaggacggggacccaggaagtgggcggtcaggaccctggggaggcagtg
cagccctgccgccaacccctgggagccagggtggccgacaaggtgaggaagcggaggaag
gtggatgagggtgctggggacagtgctgcggtggccagtggtggtgcccagaccttggcc
cttgccgggtcccctgccccatcggggcaccccaaggctggacacagtgagaacggggtt
gaggaggacacagaaggtcgaacggggcccaaagaaggtacccctgggagcccatcggag
accccaggccccagcccagcaggacctgcaggggacgagccagccgagagcccatcggag
accccaggcccccgcccagcaggacctgcaggggacgagccagccgagagcccatcggag
accccaggcccccgcccggcaggacctgcaggggacgagccagccgagagcccatcggag
accccaggccccagcccggcaggacctacaagggatgagccagccgagagcccatcggag
accccaggcccccgcccggcaggacctgcaggggacgagccagccgagagcccatcggag
accccaggcccccgcccggcaggacctgcaggggacgagccagccgagagcccatcggag
accccaggccccagcccggcaggacctacaagggatgagccagccaaggcgggggaggca
gcagagttgcaggacgcagaggtggagtcttctgccaagtctgggaagccttaa

DBGET integrated database retrieval system