KEGG   Homo sapiens (human): 11055Help
Entry
11055             CDS       T01001                                 

Gene name
ZPBP, ZPBP1
Definition
(RefSeq) zona pellucida binding protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Sp38 Ig_3 Ig_2 ig V-set I-set
Motif
Other DBs
NCBI-GeneID: 11055
NCBI-ProteinID: NP_008940
OMIM: 608498
HGNC: 15662
Ensembl: ENSG00000042813
Vega: OTTHUMG00000023528
Pharos: Q9BS86(Tdark)
UniProt: Q9BS86
Position
7p12.2
AA seq 351 aa AA seqDB search
MEAFALGPARRGRRRTRAAGSLLSRAAILLFISAFLVRVPSSVGHLVRLPRAFRLTKDSV
KIVGSTSFPVKAYVMLHQKSPHVLCVTQQLRNAELIDPSFQWYGPKGKVVSVENRTAQIT
STGSLVFQNFEESMSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYYQFTARYHAA
PCNSIYNISFEKKLLQILSKLLLDLSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLD
TEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILGRRAEQLPQIYYIEGTLQMVWIN
RCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSLVYGAKTCL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaggccttcgcccttggcccagcgcggcggggcaggcggcggacccgggccgccggc
tccctgctctctcgggccgccatcctcctctttatctccgccttcctggtgcgggtgccc
tcatcagttggacacttggttcgattaccaagagcttttcgcttgaccaaagattcagtg
aaaatagtgggatcaacaagttttccagtgaaagcgtatgtcatgctccatcaaaagagt
ccacacgtgttatgtgtaacgcaacaactgcgaaatgctgaactgatagacccatcattc
caatggtatgggcctaaaggaaaagttgtttcagtagaaaaccgcactgcacaaataaca
tccacaggaagccttgtattccaaaattttgaggagagtatgagtggaatttatacatgt
ttcctcgaatataaacctactgtggaagaaattgttaaacgtcttcaactaaaatatgct
atatatgcttatcgtgagcctcattattattatcagttcacagctcgatatcatgcagct
ccctgcaatagcatttataatatttcttttgagaagaaacttcttcagattttaagcaaa
ctgcttcttgacctttcatgtgaaatttccttacttaagtctgaatgccatcgcgttaaa
atgcaaagagctggtttgcaaaatgaattgttctttgcattttcagtttcatctctagac
actgaaaaaggacccaagcgatgtacagaccataactgtgaaccttacaaaagacttttt
aaggctaaaaatctcatagagagattttttaatcaacaagtagaaattcttggcagacgt
gcagaacaattacctcaaatatactatattgaaggtactctccaaatggtttggattaat
cgctgctttccaggatatggaatgaatgtccagcaacatccaaaatgtcctgagtgctgt
gtgatctgcagccctggatcatataacccccgtgatggaattcattgccttcaatgcaat
agcagcctggtgtatggagcaaaaacgtgcttataa

DBGET integrated database retrieval system