KEGG   Homo sapiens (human): 11057
Entry
11057             CDS       T01001                                 
Symbol
ABHD2, HS1-2, LABH2, PHPS1-2
Name
(RefSeq) abhydrolase domain containing 2, acylglycerol lipase
  KO
K13697  abhydrolase domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    11057 (ABHD2)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Sperm associated proteins
   11057 (ABHD2)
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Ndr DUF915 Abhydrolase_6 Cutinase
Other DBs
NCBI-GeneID: 11057
NCBI-ProteinID: NP_008942
OMIM: 612196
HGNC: 18717
Ensembl: ENSG00000140526
UniProt: P08910 A0A024RC89
Position
15:89040998..89202355
AA seq 425 aa
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP
LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH
CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG
CTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL
RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL
MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS
EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQV
EADLE
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaatgccatgctggagactcccgaactcccagccgtgtttgatggagtgaagctggct
gcagtggctgctgtgctgtacgtgatcgtccggtgtttgaacctgaagagccccacagcc
ccacctgacctctacttccaggactcggggctctcacgctttctgctcaagtcctgtcct
cttctgaccaaagaatacattccaccgttgatctgggggaaaagtggacacatccagaca
gccttgtatgggaagatgggaagggtgaggtcgccacatccttatgggcaccggaagttc
atcactatgtctgatggagccacttctacattcgacctcttcgagcccttggctgagcac
tgtgttggagatgatatcaccatggtcatctgccctggaattgccaatcacagcgagaag
caatacatccgcactttcgttgactacgcccagaaaaatggctatcggtgcgccgtgctg
aaccacctgggtgccctgcccaacattgaattgacctcgccacgcatgttcacctatggc
tgcacgtgggaatttggagccatggtgaactacatcaagaagacatatcccctgacccag
ctggtcgtcgtgggcttcagcctgggtggtaacattgtgtgcaaatacttgggggagact
caggcaaaccaagagaaggtcctgtgctgcgtcagcgtgtgccaggggtacagtgcactg
agggcccaggaaaccttcatgcaatgggatcagtgccggcggttctacaacttcctcatg
gctgacaacatgaagaagatcatcctctcgcacaggcaagctctttttggagaccatgtt
aagaaaccccagagcctggaagacacggacttgagccggctctacacagcaacatccctg
atgcagattgatgacaatgtgatgaggaagtttcacggctataactccctgaaggaatac
tatgaggaagaaagttgcatgcggtacctgcacaggatttatgttcctctcatgctggtt
aatgcagctgacgatccgttggtgcatgaaagtcttctaaccattccaaaatctctttca
gagaaacgagagaacgtcatgtttgtgctgcctctgcatgggggccacttgggcttcttt
gagggctctgtgctgttccccgagcccctgacatggatggataagctggtggtggagtac
gccaacgccatttgccaatgggagcgtaacaagttgcagtgctctgacacggagcaggtg
gaggccgacctggagtga

DBGET integrated database retrieval system