KEGG   Homo sapiens (human): 11057Help
Entry
11057             CDS       T01001                                 

Gene name
ABHD2, HS1-2, LABH2, PHPS1-2
Definition
(RefSeq) abhydrolase domain containing 2
  KO
K13697  abhydrolase domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    11057 (ABHD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Ndr DUF915 Cutinase Palm_thioest
Motif
Other DBs
NCBI-GeneID: 11057
NCBI-ProteinID: NP_008942
OMIM: 612196
HGNC: 18717
Ensembl: ENSG00000140526
Vega: OTTHUMG00000148684
Pharos: P08910(Tbio)
UniProt: P08910 A0A024RC89
Position
15q26.1
AA seq 425 aa AA seqDB search
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP
LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH
CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG
CTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL
RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL
MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS
EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQV
EADLE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccatgctggagactcccgaactcccagccgtgtttgatggagtgaagctggct
gcagtggctgctgtgctgtacgtgatcgtccggtgtttgaacctgaagagccccacagcc
ccacctgacctctacttccaggactcggggctctcacgctttctgctcaagtcctgtcct
cttctgaccaaagaatacattccaccgttgatctgggggaaaagtggacacatccagaca
gccttgtatgggaagatgggaagggtgaggtcgccacatccttatgggcaccggaagttc
atcactatgtctgatggagccacttctacattcgacctcttcgagcccttggctgagcac
tgtgttggagatgatatcaccatggtcatctgccctggaattgccaatcacagcgagaag
caatacatccgcactttcgttgactacgcccagaaaaatggctatcggtgcgccgtgctg
aaccacctgggtgccctgcccaacattgaattgacctcgccacgcatgttcacctatggc
tgcacgtgggaatttggagccatggtgaactacatcaagaagacatatcccctgacccag
ctggtcgtcgtgggcttcagcctgggtggtaacattgtgtgcaaatacttgggggagact
caggcaaaccaagagaaggtcctgtgctgcgtcagcgtgtgccaggggtacagtgcactg
agggcccaggaaaccttcatgcaatgggatcagtgccggcggttctacaacttcctcatg
gctgacaacatgaagaagatcatcctctcgcacaggcaagctctttttggagaccatgtt
aagaaaccccagagcctggaagacacggacttgagccggctctacacagcaacatccctg
atgcagattgatgacaatgtgatgaggaagtttcacggctataactccctgaaggaatac
tatgaggaagaaagttgcatgcggtacctgcacaggatttatgttcctctcatgctggtt
aatgcagctgacgatccgttggtgcatgaaagtcttctaaccattccaaaatctctttca
gagaaacgagagaacgtcatgtttgtgctgcctctgcatgggggccacttgggcttcttt
gagggctctgtgctgttccccgagcccctgacatggatggataagctggtggtggagtac
gccaacgccatttgccaatgggagcgtaacaagttgcagtgctctgacacggagcaggtg
gaggccgacctggagtga

DBGET integrated database retrieval system