KEGG   Homo sapiens (human): 11061
Entry
11061             CDS       T01001                                 
Symbol
CNMD, BRICD3, CHM-I, CHM1, LECT1, MYETS1
Name
(RefSeq) chondromodulin
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BRICHOS
Other DBs
NCBI-GeneID: 11061
NCBI-ProteinID: NP_008946
OMIM: 605147
HGNC: 17005
Ensembl: ENSG00000136110
Pharos: O75829(Tbio)
UniProt: O75829
Position
13:complement(52703264..52739820)
AA seq 334 aa
MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIG
AFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGI
TGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVK
DNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGR
LNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPL
GGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgacagagaactccgacaaagttcccattgccctggtgggacctgatgacgtggaattc
tgcagccccccggcgtacgctacgctgacggtgaagccctccagccccgcgcggctgctc
aaggtgggagccgtggtcctcatttcgggagctgtgctgctgctctttggggccatcggg
gccttctacttctggaaggggagcgacagtcacatttacaatgtccattacaccatgagt
atcaatgggaaattacaagatgggtcaatggaaatagacgctgggaacaacttggagacc
tttaaaatgggaagtggagctgaagaagcaattgcagttaatgatttccagaatggcatc
acaggaattcgttttgctggaggagagaagtgctacattaaagcgcaagtgaaggctcgt
attcctgaggtgggcgccgtgaccaaacagagcatctcctccaaactggaaggcaagatc
atgccagtcaaatatgaagaaaattctcttatctgggtggctgtagatcagcctgtgaag
gacaacagcttcttgagttctaaggtgttagaactctgcggtgaccttcctattttctgg
cttaaaccaacctatccaaaagaaatccagagggaaagaagagaagtggtaagaaaaatt
gttccaactaccacaaaaagaccacacagtggaccacggagcaacccaggcgctggaaga
ctgaataatgaaaccagacccagtgttcaagaggactcacaagccttcaatcctgataat
ccttatcatcagcaggaaggggaaagcatgacattcgaccctagactggatcacgaagga
atctgttgtatagaatgtaggcggagctacacccactgccagaagatctgtgaacccctg
gggggctattacccatggccttataattatcaaggctgccgttcggcctgcagagtcatc
atgccatgtagctggtgggtggcccgtatcttgggcatggtgtga

DBGET integrated database retrieval system