KEGG   Homo sapiens (human): 11070
Entry
11070             CDS       T01001                                 
Symbol
TMEM115, PL6
Name
(RefSeq) transmembrane protein 115
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF1751 DUF4305
Other DBs
NCBI-GeneID: 11070
NCBI-ProteinID: NP_008955
OMIM: 607069
HGNC: 30055
Ensembl: ENSG00000126062
UniProt: Q12893 A0A024R2Y2
Position
3:complement(50354750..50359521)
AA seq 351 aa
MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIW
TLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLT
YMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLL
RLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLA
NLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVED
QSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgcaacgtgccctgccaggcgcccgccagcacttgggggccattctggccagcgccagc
gtggtggtgaaggctctgtgtgcggcggtactattcctctacctgctctccttcgccgtg
gacacaggctgcctggcggtcaccccgggctacctctttcctcccaacttctggatctgg
accctggccacccatgggctgatggagcagcatgtgtgggacgtggccatcagcctgaca
acggtggtggtggccgggcgtttgctggagcccctctggggggccttggagctgctcatc
ttcttctcagtggtgaatgtgtctgtagggctgctgggggccttcgcctacctcctcacc
tacatggcttccttcaacctggtctacctgttcactgtccgtatccacggcgccttgggc
ttcctaggtggcgtcctggtggcactcaagcaaaccatgggggactgtgtggtcctgcga
gtgccccaggtgcgcgtcagtgtgatgcccatgctgctgctggcgctgctgctcctgctg
cggctcgccacgctgctccagagcccggcgctggcttcctatggcttcgggctgctctcc
agttgggtatatcttcgcttctaccagcgccatagccggggccgaggggacatggctgac
cactttgctttcgccactttcttccctgagatcctgcagcctgtggtgggtttgctggcg
aacttggtgcacagcctcctggtgaaggtaaagatatgccagaagacggtgaagcgctac
gatgtgggtgccccatcctccatcaccatcagcctgccaggcacagaccctcaagacgcc
gagcggagaaggcaactggccctgaaggcactcaatgagcggctgaagagagtggaagac
cagtccatctggcccagcatggatgatgatgaagaggagtctggggccaaggtggacagc
cccctgccctcagacaaagctcccacacccccagggaagggggctgccccagaatccagt
ctaatcaccttcgaggcagctcccccgacgctgtaa

DBGET integrated database retrieval system