KEGG   Homo sapiens (human): 11073Help
Entry
11073             CDS       T01001                                 

Gene name
TOPBP1, Dpb11, TOP2BP1
Definition
(RefSeq) DNA topoisomerase II binding protein 1
  KO
K10728  topoisomerase (DNA) II binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    11073 (TOPBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    11073 (TOPBP1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    11073 (TOPBP1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    11073 (TOPBP1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-B complex
     11073 (TOPBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRCT PTCB-BRCT BRCT_2 LIG3_BRCT RTT107_BRCT_5
Motif
Other DBs
NCBI-GeneID: 11073
NCBI-ProteinID: NP_008958
OMIM: 607760
HGNC: 17008
Ensembl: ENSG00000163781
Vega: OTTHUMG00000159773
Pharos: Q92547(Tbio)
UniProt: Q92547 Q05BV8 A0AV47 A7E2X7
Structure
PDB: 

Position
3q22.1
AA seq 1522 aa AA seqDB search
MSRNDKEPFFVKFLKSSDNSKCFFKALESIKEFQSEEYLQIITEEEALKIKENDRSLYIC
DPFSGVVFDHLKKLGCRIVGPQVVIFCMHHQRCVPRAEHPVYNMVMSDVTISCTSLEKEK
REEVHKYVQMMGGRVYRDLNVSVTHLIAGEVGSKKYLVAANLKKPILLPSWIKTLWEKSQ
EKKITRYTDINMEDFKCPIFLGCIICVTGLCGLDRKEVQQLTVKHGGQYMGQLKMNECTH
LIVQEPKGQKYECAKRWNVHCVTTQWFFDSIEKGFCQDESIYKTEPRPEAKTMPNSSTPT
SQINTIDSRTLSDVSNISNINASCVSESICNSLNSKLEPTLENLENLDVSAFQAPEDLLD
GCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPH
VVGAKWLLECFSKGYMLSEEPYIHANYQPVEIPVSHKPESKAALLKKKNSSFSKKDFAPS
EKHEQADEDLLSQYENGSSTVVEAKTSEARPFNDSTHAEPLNDSTHISLQEENQSSVSHC
VPDVSTITEEGLFSQKSFLVLGFSNENESNIANIIKENAGKIMSLLSRTVADYAVVPLLG
CEVEATVGEVVTNTWLVTCIDYQTLFDPKSNPLFTPVPVMTGMTPLEDCVISFSQCAGAE
KESLTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERGGSKYEAAKKWNLPAVTIAW
LLETARTGKRADESHFLIENSTKEERSLETEITNGINLNSDTAEHPGTRLQTHRKTVVTP
LDMNRFQSKAFRAVVSQHARQVAASPAVGQPLQKEPSLHLDTPSKFLSKDKLFKPSFDVK
DALAALETPGRPSQQKRKPSTPLSEVIVKNLQLALANSSRNAVALSASPQLKEAQSEKEE
APKPLHKVVVCVSKKLSKKQSELNGIAASLGADYRWSFDETVTHFIYQGRPNDTNREYKS
VKERGVHIVSEHWLLDCAQECKHLPESLYPHTYNPKMSLDISAVQDGRLCNSRLLSAVSS
TKDDEPDPLILEENDVDNMATNNKESAPSNGSGKNDSKGVLTQTLEMRENFQKQLQEIMS
ATSIVKPQGQRTSLSRSGCNSASSTPDSTRSARSGRSRVLEALRQSRQTVPDVNTEPSQN
EQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLHDSEIAKQAVC
DPGNIRVTEAPKHPISEELETPIKDSHLIPTPQAPSIAFPLANPPVAPHPREKIITIEET
HEELKKQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKYLA
SVAAGKWVLHRSYLEACRTAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAAMRWRKK
IQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSGGAKVLPGHSVPLFKEATHLFSD
LNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELG
TGLSQKRKAPTEKNKIKRPRVH
NT seq 4569 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaatgacaaagaaccgttttttgtgaagtttttaaagtcttcagacaattcc
aaatgtttttttaaagctctcgagtccataaaagaattccaatcagaagaatatcttcag
attattacagaagaagaggcattgaagataaaggagaatgatagatcactttatatctgt
gacccttttagtggcgttgtctttgatcacctcaaaaagcttggctgcagaattgttggt
cctcaagtagtcatattttgtatgcaccaccagcgatgtgtcccaagagccgaacatcca
gtttataatatggttatgtctgatgtaaccatatcttgtacaagtctggaaaaagaaaaa
agggaagaagttcataaatatgtacaaatgatgggcggacgagtatacagagaccttaat
gtatcagtaactcaccttattgcaggagaagttggtagcaaaaaatatttagttgctgca
aacctgaagaaacctattttgcttccctcttggataaaaacactttgggagaagtcacaa
gagaaaaaaataactagatatactgatataaacatggaagatttcaagtgtcctattttt
cttggttgcataatctgtgtgactggcttatgtggcttagacaggaaagaagttcagcaa
ctcacagttaagcatggaggtcaatacatgggacaattgaaaatgaatgaatgtacacac
ctcattgtgcaagaaccaaaaggtcagaagtatgagtgtgccaagagatggaatgtacac
tgtgtgaccacacagtggttttttgacagtattgagaaaggtttttgtcaggatgaatcc
atatacaagacagaacctagaccagaagcaaagactatgcccaattcttcaactcctacc
agccagatcaacacaattgatagtcgtactctttcagatgtcagcaatatttccaacata
aatgcaagttgcgtaagtgaatcaatatgtaattcacttaacagcaaactggagcctaca
cttgaaaatctagaaaatctggatgtcagtgcatttcaagcacctgaagatttattagat
ggttgtcggatatatctttgcggttttagtggcagaaagctagataaactgagaagactt
attaacagtggaggtggagttcgttttaaccagctaaatgaagatgtaactcatgttatt
gtgggagattatgatgatgaattgaagcagttttggaataaatcagcccacaggcctcat
gtagtgggagcaaagtggttgctagagtgtttcagtaaaggttatatgctttctgaagaa
ccatatatccatgctaattaccagccagtggaaattccagtttcacataagcctgaaagt
aaagcagctcttttaaaaaagaagaacagcagcttctctaagaaagactttgctcctagt
gaaaagcatgagcaagctgatgaagatctgctctctcaatatgaaaatggtagctccaca
gtagttgaggctaagacgtctgaagccaggccctttaatgattctactcatgctgagccc
ttgaatgattctactcacatttctttgcaagaagaaaaccagtcttctgtcagtcattgt
gtccctgatgtttctacaattactgaagaaggcttatttagccaaaagagtttccttgtt
ttgggttttagtaatgaaaatgaatctaacatcgcaaacatcataaaagaaaatgctggg
aaaatcatgtcccttctgagcagaactgttgcggattatgctgtggttcctctgctgggg
tgtgaagtggaagccactgtgggagaagttgttacaaatacatggctggttacttgcata
gactatcagactttgtttgatccaaagtcgaatcctctcttcacaccagttccagtaatg
acaggaatgactcctttagaggattgtgttatttcatttagccagtgtgctggagcagaa
aaagagtctttaacattcctagcaaacctccttggagcaagtgttcaagaatactttgtt
cgcaaatccaatgcaaagaaaggcatgtttgccagtactcatcttatactgaaagaacgt
ggtggctctaaatatgaagctgcaaagaagtggaatttacctgccgttactatagcttgg
ctgttggagactgctagaacgggaaagagagcagacgaaagccattttctgattgaaaat
tcaactaaagaagaacgaagtttggaaacagaaataacaaatggaatcaatctaaattca
gatactgcagagcatcctggcacacgcctgcaaactcacagaaaaaccgtcgttacacct
ttagatatgaaccgctttcagagtaaagctttccgtgctgtggtctcacaacatgccaga
caggtcgcagcctccccagcagtaggacaaccacttcagaaggagccctcgttacacctg
gatacaccatcaaaattcctgtccaaggacaaactcttcaagccttcctttgatgtgaag
gatgcacttgcagccttggaaactccaggacgtcccagccaacagaaaaggaaaccgagt
acgccactctcagaagttattgtcaaaaacttgcaacttgctttggcaaatagctctcga
aatgctgtcgctctttctgccagccctcaactgaaagaggcccagtcagagaaggaagaa
gccccaaagccacttcacaaagtagtggtatgtgttagtaaaaaactcagtaagaagcag
agtgaactaaatgggatcgcagcctctctaggagcagattacaggtggagttttgatgaa
acagtgactcatttcatctatcaagggcggccaaatgacactaatcgggagtataaatct
gtaaaagaaagaggagtacacattgtttccgagcactggcttttagattgtgcccaagag
tgtaaacatcttcctgaatctctttatccacatacttataatcccaaaatgagcttggat
atcagcgcagtgcaagatggccggctctgtaatagtcgactactctcagctgtgtcttca
acaaaggatgatgagccagatcctttgattttagaagaaaatgatgtagacaatatggcc
accaataataaagagtcagcaccatcaaatggaagtggaaagaatgactctaaaggagtt
ctgacacagaccttagagatgagagagaactttcagaagcagttacaggagataatgtct
gcaacatcaatagtgaaaccccaagggcagaggacttccctttcaagaagtggttgtaac
agcgcatcttcaacccctgacagcactcgctctgctcgcagtggacgaagtagagtccta
gaggcactgaggcagtctcgtcagacagtacctgatgtcaacacagagccttcccaaaat
gaacagatcatttgggatgaccctacagcaagggaggagagagcaaggcttgccagcaat
ttgcagtggcctagttgtcccacacaatactctgagcttcaggttgacattcaaaacttg
gaggattctccttttcaaaagcctttacatgattcagaaattgctaaacaggctgtctgt
gatcctggaaacatacgtgtgactgaagctcccaaacacccaatctctgaagaactggaa
actcccataaaagacagccacctgatccctacgcctcaagcccccagtattgcctttcca
ctcgccaacccccctgtggctccgcaccctagagaaaagattataacgatagaggagact
catgaagaattaaaaaaacagtacatatttcagttatcatctctgaatcctcaagaacgt
attgactattgtcatctgattgagaaactaggtggattggtgatagaaaagcagtgcttt
gatcccacctgtacacacattgttgtgggacatccacttcgaaacgagaagtatttagcc
tcagtggcagctgggaagtgggtgcttcatcgctcctaccttgaagcctgcaggactgct
ggacacttcgtgcaggaagaagactatgaatggggaagtagttccatacttgatgttctg
actggaatcaatgtacagcaacgaagactagcacttgcagcaatgagatggagaaaaaaa
atccagcaaagacaagaatctggcattgttgagggagcatttagtgggtggaaggttatt
ttacatgtggatcagtctcgagaagcaggcttcaaacgccttcttcagtcaggaggagca
aaggtgctacctggtcattctgtacctttatttaaagaggccacacatcttttttctgac
ttgaataaactgaaaccagatgactcaggagttaatatagcagaagctgctgcccagaac
gtgtactgcttgagaacagaatacattgctgattatctcatgcaggaatcacctcctcat
gtagaaaattactgtctaccagaagctatttcatttattcagaataataaggaacttggg
actggattatcacaaaagaggaaagctcctacagaaaaaaataaaatcaaacgacctaga
gtacactaa

DBGET integrated database retrieval system