KEGG   Homo sapiens (human): 11076Help
Entry
11076             CDS       T01001                                 

Gene name
TPPP, TPPP/p25, TPPP1, p24, p25, p25alpha
Definition
(RefSeq) tubulin polymerization promoting protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: p25-alpha DUF1018
Motif
Other DBs
NCBI-GeneID: 11076
NCBI-ProteinID: NP_008961
OMIM: 608773
HGNC: 24164
Ensembl: ENSG00000171368
Vega: OTTHUMG00000131011
Pharos: O94811(Tbio)
UniProt: O94811 Q4L233
Position
5p15.33
AA seq 219 aa AA seqDB search
MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAV
HGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEAL
EELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERF
DPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaggccaagcctgccaaagctgccaacaggacgccccccaagtccccgggg
gacccctcgaaggaccgggcagccaagaggctgtcgctggaatcggagggtgctggtgag
ggggcagccgcatcccctgagctcagtgccctggaggaggccttccggcgctttgccgtg
cacggggacgccagggccaccgggagggagatgcacggcaagaactggtcgaagctgtgc
aaggactgccaggtgatcgacggcaggaacgtgaccgtcactgacgtggacatcgtcttc
agcaagatcaaagggaagtcttgccggaccatcacctttgagcagttccaggaggcgctg
gaggagctcgccaagaagcgattcaaagacaagagcagcgaggaggccgttcgcgaggtg
cacaggctcatcgagggcaaggcgcccatcatctcaggggtgacgaaagccatctcgtcg
cccacagtgtcgaggctcacggacaccaccaagttcacgggctcccacaaggagcgcttc
gacccctctggcaagggcaagggcaaggctggccgcgtggatctggtggacgagtcaggc
tatgtgtccggctacaagcacgcaggcacctacgaccagaaggtgcaagggggcaagtag

DBGET integrated database retrieval system