KEGG   Homo sapiens (human): 11079
Entry
11079             CDS       T01001                                 

Gene name
RER1
Definition
(RefSeq) retention in endoplasmic reticulum sorting receptor 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Rer1 DUF2208
Other DBs
NCBI-GeneID: 11079
NCBI-ProteinID: NP_008964
HGNC: 30309
Ensembl: ENSG00000157916
Vega: OTTHUMG00000001403
Pharos: O15258(Tbio)
UniProt: O15258 Q5T094
Position
1p36.32
AA seq 196 aa
MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYL
LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK
FWHAATKGILVAMVCTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG
KRRYRGKEDAGKAFAS
NT seq 591 nt   +upstreamnt  +downstreamnt
atgtctgaaggggacagtgtgggagaatccgtccatgggaaaccttcggtggtgtacaga
tttttcacaagacttggacagatttatcagtcctggctagacaagtccacaccctacacg
gctgtgcgatgggtcgtgacactgggcctgagctttgtctacatgattcgagtttacctg
ctgcagggttggtacattgtgacctatgccttggggatctaccatctaaatcttttcata
gcttttctttctcccaaagtggatccttccttaatggaagactcagatgacggtccttcg
ctacccaccaaacagaacgaggaattccgccccttcattcgaaggctcccagagtttaaa
ttttggcatgcggctaccaagggcatccttgtggctatggtctgtactttcttcgacgct
ttcaacgtcccggtgttctggccgattctggtgatgtacttcatcatgctcttctgtatc
acgatgaagaggcaaatcaagcacatgattaagtaccggtacatcccgttcacacatggg
aagagaaggtacagaggcaaggaggatgccggcaaggccttcgccagctag

DBGET integrated database retrieval system