KEGG   Homo sapiens (human): 11082Help
Entry
11082             CDS       T01001                                 

Gene name
ESM1, endocan
Definition
(RefSeq) endothelial cell specific molecule 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: IGFBP
Motif
Other DBs
NCBI-GeneID: 11082
NCBI-ProteinID: NP_008967
OMIM: 601521
HGNC: 3466
Ensembl: ENSG00000164283
Vega: OTTHUMG00000097010
Pharos: Q9NQ30(Tbio)
UniProt: Q9NQ30
Position
5q11.2
AA seq 184 aa AA seqDB search
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAG
RGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSG
ICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKW
LNPR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcgtcttgctgctgaccacgctcctcgtgcctgcacacctggtggccgcctgg
agcaataattatgcggtggactgccctcaacactgtgacagcagtgagtgcaaaagcagc
ccgcgctgcaagaggacagtgctcgacgactgtggctgctgccgagtgtgcgctgcaggg
cggggagaaacttgctaccgcacagtctcaggcatggatggcatgaagtgtggcccgggg
ctgaggtgtcagccttctaatggggaggatccttttggtgaagagtttggtatctgcaaa
gactgtccctacggcaccttcgggatggattgcagagagacctgcaactgccagtcaggc
atctgtgacagggggacgggaaaatgcctgaaattccccttcttccaatattcagtaacc
aagtcttccaacagatttgtttctctcacggagcatgacatggcatctggagatggcaat
attgtgagagaagaagttgtgaaagagaatgctgccgggtctcccgtaatgaggaaatgg
ttaaatccacgctga

DBGET integrated database retrieval system