KEGG   Homo sapiens (human): 11091Help
Entry
11091             CDS       T01001                                 

Gene name
WDR5, BIG-3, CFAP89, SWD3
Definition
(RefSeq) WD repeat domain 5
  KO
K14963  COMPASS component SWD3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    11091 (WDR5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    11091 (WDR5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    NSL complex
     11091 (WDR5)
   HMT complexes
    COMPASS/SET1 complex
     11091 (WDR5)
    COMPASS/SET1 complex (yeast)
     11091 (WDR5)
    MLL-HCF complex
     11091 (WDR5)
    MLL3/MLL4 complex
     11091 (WDR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 eIF2A WD40_like Ge1_WD40 Frtz VID27 CDtoxinA Nucleoporin_N
Motif
Other DBs
NCBI-GeneID: 11091
NCBI-ProteinID: NP_060058
OMIM: 609012
HGNC: 12757
Ensembl: ENSG00000196363
Vega: OTTHUMG00000131707
Pharos: P61964(Tchem)
UniProt: P61964
Structure
PDB: 

Position
9q34.2
AA seq 334 aa AA seqDB search
MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWL
ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN
RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKL
WDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH
TDVVISTACHPTENIIASAALENDKTIKLWKSDC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaggagaagaagcccgagaccgaggccgccagagcacagccaaccccttcg
tcatccgccactcagagcaagcctacacctgtgaagccaaactatgctctaaagttcacc
cttgctggccacaccaaagcagtgtcctccgtgaaattcagcccgaatggagagtggctg
gcaagttcatctgctgataaacttattaaaatttggggcgcgtatgatgggaaatttgag
aaaaccatatctggtcacaagctgggaatatccgatgtagcctggtcgtcagattctaac
cttcttgtttctgcctcagatgacaaaaccttgaagatatgggacgtgagctcgggcaag
tgtctgaaaaccctgaagggacacagtaattatgtcttttgctgcaacttcaatccccag
tccaaccttattgtctcaggatcctttgacgaaagcgtgaggatatgggatgtgaaaaca
gggaagtgcctcaagactttgccagctcactcggatccagtctcggccgttcattttaat
cgtgatggatccttgatagtttcaagtagctatgatggtctctgtcgcatctgggacacc
gcctcaggccagtgcctgaagacgctcatcgatgacgacaacccccccgtgtcttttgtg
aagttctccccgaacggcaaatacatcctggccgccacgctggacaacactctgaagctc
tgggactacagcaaggggaagtgcctgaagacgtacactggccacaagaatgagaaatac
tgcatatttgccaatttctctgttactggtgggaagtggattgtgtctggctcagaggat
aaccttgtttacatctggaaccttcagacgaaagagattgtacagaaactacaaggccac
acagatgtcgtgatctcaacagcttgtcacccaacagaaaacatcatcgcctctgctgcg
ctagaaaatgacaaaacaattaaactgtggaagagtgactgctaa

DBGET integrated database retrieval system