KEGG   Homo sapiens (human): 11092Help
Entry
11092             CDS       T01001                                 

Gene name
SPACA9, C9orf9, Mast
Definition
(RefSeq) sperm acrosome associated 9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SPACA9 Sec34 PLU-1 Acetyltransf_11
Motif
Other DBs
NCBI-GeneID: 11092
NCBI-ProteinID: NP_001303826
HGNC: 1367
Ensembl: ENSG00000165698
Vega: OTTHUMG00000020847
Pharos: Q96E40(Tdark)
UniProt: Q96E40 A0A024R8F2
Position
9q34.13
AA seq 222 aa AA seqDB search
MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSS
TDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHD
VVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHVSEPQAHQESTRGAA
RPAQAIGTQPRATKHKCRQLTKASLKPRGCSKPPWRPPGGKL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggtgaaagaatcccttcgcagcatcgagcagaagtacaagctcttccagcag
cagcagctcaccttcaccgccgctctggagcactgcagggagaacgcccacgacaagatc
cggcccatctccagcattggacaggtgcagagctacatggaacactactgcaacagctcc
acagaccggcgggttctgctcatgttcctggacatctgttcagagctgaataagctctgc
cagcactttgaggccgtgcactctggcaccccagtcaccaacaacctcctggagaaatgc
aaaaccctcgttagccaaagcaacgacttaagcagcctcagagcaaaataccctcatgat
gtggtgaaccacctcagctgtgacgaggcccggaaccactacggcggcgtggtcagcctc
atccccctcatcctagacttaatgaaagaatggatcgcccactccgagaagttgccgcgc
aaggtgctgcagcacgtgagtgagccccaggcgcaccaggagagcaccaggggagccgct
cgtcctgcccaggccatagggacccagcccagggccactaaacacaagtgtagacagctc
acaaaagccagcctcaaacccaggggatgttcaaaaccaccctggaggcctcctggtggg
aaattgtaa

DBGET integrated database retrieval system