KEGG   Homo sapiens (human): 11096Help
Entry
11096             CDS       T01001                                 

Gene name
ADAMTS5, ADAM-TS_11, ADAM-TS_5, ADAM-TS5, ADAMTS-11, ADAMTS-5, ADAMTS11, ADMP-2
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 5
  KO
K08620  a disintegrin and metalloproteinase with thrombospondin motifs 5 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    11096 (ADAMTS5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     11096 (ADAMTS5)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   11096 (ADAMTS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADAM_spacer1 Reprolysin ADAM_CR_2 Reprolysin_5 Reprolysin_3 Pep_M12B_propep TSP_1 Reprolysin_2 Reprolysin_4 Peptidase_M10 DUF4953 Peptidase_M78
Motif
Other DBs
NCBI-GeneID: 11096
NCBI-ProteinID: NP_008969
OMIM: 605007
HGNC: 221
Ensembl: ENSG00000154736
Vega: OTTHUMG00000078686
Pharos: Q9UNA0(Tchem)
UniProt: Q9UNA0
Structure
PDB: 

Position
21q21.3
AA seq 930 aa AA seqDB search
MLLGWASLLLCAFRLPLAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGH
PHPLAQRRRSKGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGT
SAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGR
VYGDGSARILHVYTREGFSFEALPPRASCETPASTPEAHEHAPAHSNPSGRAALASQLLD
QSALSPAGGSGPQTWWRRRRRSISRARQVELLLVADASMARLYGRGLQHYLLTLASIANR
LYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYD
AAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSH
DDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQI
LGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGT
PCGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPR
NNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVL
PADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVRGKCVRTGCDGIIGSKLQYDK
CGVCGGDNSSCTKIVGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKKK
NGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPT
KPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTV
QCQDGNRKLAKGCPLSQRPSAFKQCLLKKC
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcgggtgggcgtccctgctgctgtgcgcgttccgcctgcccctggccgcggtc
ggccccgccgcgacacctgcccaggataaagccgggcagcctccgactgctgcagcagcc
gcccagccccgccggcggcagggggaggaggtgcaggagcgagccgagcctcccggccac
ccgcaccccctggcgcagcggcgcaggagcaaggggctggtgcagaacatcgaccaactc
tactccggcggcggcaaggtgggctacctcgtctacgcgggcggccggaggttcctcttg
gacctggagcgagatggttcggtgggcattgctggcttcgtgcccgcaggaggcgggacg
agtgcgccctggcgccaccggagccactgcttctatcggggcacagtggacggtagtccc
cgctctctggctgtctttgacctctgtgggggtctcgacggcttcttcgcggtcaagcac
gcgcgctacaccctaaagccactgctgcgcggaccctgggcggaggaagaaaaggggcgc
gtgtacggggatgggtccgcacggatcctgcacgtctacacccgcgagggcttcagcttc
gaggccctgccgccgcgcgccagctgcgaaacccccgcgtccacaccggaggcccacgag
catgctccggcgcacagcaacccgagcggacgcgcagcactggcctcgcagctcttggac
cagtccgctctctcgcccgctgggggctcaggaccgcagacgtggtggcggcggcggcgc
cgctccatctcccgggcccgccaggtggagctgcttctggtggctgacgcgtccatggcg
cggttgtatggccggggcctgcagcattacctgctgaccctggcctccatcgccaatagg
ctgtacagccatgctagcatcgagaaccacatccgcctggccgtggtgaaggtggtggtg
ctaggcgacaaggacaagagcctggaagtgagcaagaacgctgccaccacactcaagaac
ttttgcaagtggcagcaccaacacaaccagctgggagatgaccatgaggagcactacgat
gcagctatcctgtttactcgggaggatttatgtgggcatcattcatgtgacaccctggga
atggcagacgttgggaccatatgttctccagagcgcagctgtgctgtgattgaagacgat
ggcctccacgcagccttcactgtggctcacgaaatcggacatttacttggcctctcccat
gacgattccaaattctgtgaagagacctttggttccacagaagataagcgcttaatgtct
tccatccttaccagcattgatgcatctaagccctggtccaaatgcacttcagccaccatc
acagaattcctggatgatggccatggtaactgtttgctggacctaccacgaaagcagatc
ctgggccccgaagaactcccaggacagacctacgatgccacccagcagtgcaacctgaca
ttcgggcctgagtactccgtgtgtcccggcatggatgtctgtgctcgcctgtggtgtgct
gtggtacgccagggccagatggtctgtctgaccaagaagctgcctgcggtggaagggacg
ccttgtggaaaggggagaatctgcctgcagggcaaatgtgtggacaaaaccaagaaaaaa
tattattcaacgtcaagccatggcaactggggatcttggggatcctggggccagtgttct
cgctcatgtggaggaggagtgcagtttgcctatcgtcactgtaataaccctgctcccaga
aacaacggacgctactgcacagggaagagggccatctaccgctcctgcagtctcatgccc
tgcccacccaatggtaaatcatttcgtcatgaacagtgtgaggccaaaaatggctatcag
tctgatgcaaaaggagtcaaaacttttgtggaatgggttcccaaatatgcaggtgtcctg
ccagcggatgtgtgcaagctgacctgcagagccaagggcactggctactatgtggtattt
tctccaaaggtgaccgatggcactgaatgtaggctgtacagtaattccgtctgcgtccgg
gggaagtgtgtgagaactggctgtgacggcatcattggctcaaagctgcagtatgacaag
tgcggagtatgtggaggagacaactccagctgtacaaagattgttggaacctttaataag
aaaagtaagggttacactgacgtggtgaggattcctgaaggggcaacccacataaaagtt
cgacagttcaaagccaaagaccagactagattcactgcctatttagccctgaaaaagaaa
aacggtgagtaccttatcaatggaaagtacatgatctccacttcagagactatcattgac
atcaatggaacagtcatgaactatagcggttggagccacagggatgacttcctgcatggc
atgggctactctgccacgaaggaaattctaatagtgcagattcttgcaacagaccccact
aaaccattagatgtccgttatagcttttttgttcccaagaagtccactccaaaagtaaac
tctgtcactagtcatggcagcaataaagtgggatcacacacttcgcagccgcagtgggtc
acgggcccatggctcgcctgctctaggacctgtgacacaggttggcacaccagaacggtg
cagtgccaggatggaaaccggaagttagcaaaaggatgtcctctctcccaaaggccttct
gcgtttaagcaatgcttgttgaagaaatgttag

DBGET integrated database retrieval system