KEGG   Homo sapiens (human): 11097
Entry
11097             CDS       T01001                                 
Symbol
NUP42, CG1, NLP-1, NLP1, NLP_1, NUPL2, UIP1, hCG1
Name
(RefSeq) nucleoporin 42
  KO
K14321  nucleoporin-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    11097 (NUP42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    11097 (NUP42)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     11097 (NUP42)
SSDB
Motif
Pfam: zf_CCCH_4 zf-CCCH_4 zf-CCCH zf-CCCH_2 SWIRM
Other DBs
NCBI-GeneID: 11097
NCBI-ProteinID: NP_031368
OMIM: 619998
HGNC: 17010
Ensembl: ENSG00000136243
UniProt: O15504
Position
7:23182048..23201006
AA seq 423 aa
MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTTSQRYSNVIQP
SSFSKSTPWGGSRDQEKPYFSSFDSGASTNRKEGFGLSENPFASLSPDEQKDEKKLLEGI
VKDMEVWESSGQWMFSVYSPVKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQR
LINQWRNRVNELKSLNISTKVALLSDVKDGVNQAAPAFGFGSSQAATFMSPGFPVNNSSS
DNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSGISTSAPAFGFGKPEVTSAAS
FSFKSPAASSFGSPGFSGLPASLATGPVRAPVAPAFGGGSSVAGFGSPGSHSHTAFSKPS
SDTFGNSSISTSLSASSSIIATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLEL
LNV
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggccatttgtcaattcttccttcaaggccggtgccgctttggagatcggtgctggaac
gaacatcccggtgctaggggtgcaggaggaggacggcagcaaccgcagcagcagccttca
ggtaataatagacgtggatggaatacaactagccagagatattccaatgtcatccagcca
tccagtttctccaaatccacaccatgggggggcagcagagatcaagaaaagccatatttc
agttcttttgattctggagcttcaactaacaggaaggaaggctttggattgtctgagaac
ccatttgcttcacttagtcctgatgagcagaaagatgaaaagaaacttctggaaggaatt
gtaaaagatatggaggtttgggaatcatcagggcagtggatgttttctgtttattcacca
gtgaaaaagaaacctaatatttcaggttttacagacatttcaccagaggaattgaggctt
gaataccataacttcttaaccagcaataacttacagagttatctaaattctgtccaacgt
ttaataaatcaatggaggaacagggtaaatgaactgaaaagtctaaatatatcaactaaa
gtagctttgctctctgatgtaaaggatggagtaaatcaagcagcacctgcatttggattt
ggcagcagtcaagcagcaacatttatgtcgccaggctttccagtcaataacagcagcagt
gataatgctcagaactttagttttaaaacaaactctggatttgctgctgcctcttctgga
agccctgctggttttgggagttccccagcatttggagctgcagcctctaccagttcaggt
atctctacttctgctccagcttttggatttgggaagcctgaagtcacatcggctgcatca
ttttcattcaaaagccctgcagcttccagttttggatcacctggattttcaggacttcca
gcttccttggcaacaggtcctgtcagagctccagtggccccagcctttggaggtggcagt
tctgtggctggttttggtagtccgggctcacattctcacactgctttttctaagccatcc
agtgacacttttggaaatagcagcatatccacttctctgtcagcctcaagcagcatcatt
gcaacagataatgtgttattcacacccagagataaactaacagtagaagaactggaacaa
tttcaatccaagaaatttactctgggaaaaattccattaaagcctccacctctggaactt
ctaaatgtttaa

DBGET integrated database retrieval system