KEGG   Homo sapiens (human): 11098Help
Entry
11098             CDS       T01001                                 

Gene name
PRSS23, SIG13, SPUVE, ZSIG13
Definition
(RefSeq) serine protease 23
  KO
K09627  serine protease 23 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    11098 (PRSS23)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     11098 (PRSS23)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   11098 (PRSS23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 11098
NCBI-ProteinID: NP_001280108
HGNC: 14370
Ensembl: ENSG00000150687
Vega: OTTHUMG00000167226
Pharos: O95084(Tdark)
UniProt: O95084
Position
11q14.2
AA seq 383 aa AA seqDB search
MAGIPGLLFLLFFLLCAVGQVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLE
VSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGAQHRDSGS
SGKSRRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDG
KTYVKGTQKLRVGFLKPKFKDGGRGANDSTSAMPEQMKFQWIRVKRTHVPKGWIKGNAND
IGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDE
TYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWERKIIGIFSGHQWVDMNGSPQDFNVAVR
ITPLKYAQICYWIKGNYLDCREG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcagggattccagggctcctcttccttctcttctttctgctctgtgctgttgggcaa
gtgagcccttacagtgccccctggaaacccacttggcctgcataccgcctccctgtcgtc
ttgccccagtctaccctcaatttagccaagccagactttggagccgaagccaaattagaa
gtatcttcttcatgtggaccccagtgtcataagggaactccactgcccacttacgaagag
gccaagcaatatctgtcttatgaaacgctctatgccaatggcagccgcacagagacgcag
gtgggcatctacatcctcagcagtagtggagatggggcccaacaccgagactcagggtct
tcaggaaagtctcgaaggaagcggcagatttatggctatgacagcaggttcagcattttt
gggaaggacttcctgctcaactaccctttctcaacatcagtgaagttatccacgggctgc
accggcaccctggtggcagagaagcatgtcctcacagctgcccactgcatacacgatgga
aaaacctatgtgaaaggaacccagaagcttcgagtgggcttcctaaagcccaagtttaaa
gatggtggtcgaggggccaacgactccacttcagccatgcccgagcagatgaaatttcag
tggatccgggtgaaacgcacccatgtgcccaagggttggatcaagggcaatgccaatgac
atcggcatggattatgattatgccctcctggaactcaaaaagccccacaagagaaaattt
atgaagattggggtgagccctcctgctaagcagctgccagggggcagaattcacttctct
ggttatgacaatgaccgaccaggcaatttggtgtatcgcttctgtgacgtcaaagacgag
acctatgacttgctctaccagcaatgcgatgcccagccaggggccagcgggtctggggtc
tatgtgaggatgtggaagagacagcagcagaagtgggagcgaaaaattattggcattttt
tcagggcaccagtgggtggacatgaatggttccccacaggatttcaacgtggctgtcaga
atcactcctctcaaatatgcccagatttgctattggattaaaggaaactacctggattgt
agggaggggtga

DBGET integrated database retrieval system