KEGG   Homo sapiens (human): 11102Help
Entry
11102             CDS       T01001                                 

Gene name
RPP14, P14
Definition
(RefSeq) ribonuclease P/MRP subunit p14
  KO
K14529  ribonuclease P protein subunit RPP14 [EC:3.1.26.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    11102 (RPP14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    11102 (RPP14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     11102 (RPP14)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    11102 (RPP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_P_Rpp14
Motif
Other DBs
NCBI-GeneID: 11102
NCBI-ProteinID: NP_001092253
OMIM: 606112
HGNC: 30327
Ensembl: ENSG00000163684
Vega: OTTHUMG00000159152
Pharos: O95059(Tdark)
UniProt: O95059
Structure
PDB: 

Position
3p14.3
AA seq 124 aa AA seqDB search
MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALP
LDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRE
LVLD
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccctgctgccacatatgaaagagtagtttacaaaaacccttccgagtaccac
tacatgaaagtctgcctagaatttcaagattgtggagttggactgaatgctgcacagttc
aaacagctgcttatttcggctgtgaaggacctgtttggggaggttgatgccgccttacct
ttggacatcctaacctatgaagagaagaccttgtcagccatcttgagaatatgtagcagt
ggtcttgtcaaattgtggagctctttgaccctgttaggatcctataaaggcaaaaaatgt
gctttccgggtgattcaggtttctccatttcttcttgcattatctggtaatagtagggaa
ctagtattggattga

DBGET integrated database retrieval system