KEGG   Homo sapiens (human): 11104Help
Entry
11104             CDS       T01001                                 

Gene name
KATNA1
Definition
(RefSeq) katanin catalytic subunit A1
  KO
K07767  katanin p60 ATPase-containing subunit A1 [EC:5.6.1.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    11104 (KATNA1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.1  microtubule-severing ATPase
     11104 (KATNA1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     11104 (KATNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 Vps4_C AAA_2 RuvB_N AAA_33 AAA_5 AAA_22 TIP49 IstB_IS21 Mg_chelatase AAA_16 AAA_14 AAA_7 TsaE PhoH AAA_18 RNA_helicase ABC_tran TPR_1 Sigma54_activat Guanylate_kin TPR_8 NACHT
Motif
Other DBs
NCBI-GeneID: 11104
NCBI-ProteinID: NP_008975
OMIM: 606696
HGNC: 6216
Ensembl: ENSG00000186625
Vega: OTTHUMG00000015787
Pharos: O75449(Tbio)
UniProt: O75449 A8K7S5
Structure
PDB: 

Position
6q25.1
AA seq 491 aa AA seqDB search
MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEIN
VEAKHVKDIMKTLESFKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQY
SDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETN
KFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRR
PWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
SPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATN
FPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGAD
ITNVCRDASLMAMRRRIEGLTPEEIRNLSKEEMHMPTTMEDFEMALKKVSKSVSAADIER
YEKWIFEFGSC
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcttatgattagtgagaatgtaaaattggctcgtgaatatgcattgctggga
aactatgactctgcgatggtctattatcagggagttcttgaccaaatgaacaagtatctg
tactcagtcaaagatacatacctccagcagaaatggcaacaggtttggcaggaaataaat
gtggaagctaaacatgttaaagatatcatgaaaacactagagagctttaaactggacagc
actcccttgaaagcggcacagcatgaccttccagcttctgagggagaagtctggtccatg
cctgtacctgttgaacgaagaccctcaccaggacctagaaaacgccaatcttctcagtac
agtgaccctaaatcacatggtaatcgtccaagtacaactgtcagagttcaccgttcatct
gcacagaatgttcacaatgacagagggaaagctgttcgttgtcgtgaaaagaaagaacag
aataaaggaagagaggaaaagaacaaatcacctgctgcagtaacagaaccagagacaaat
aaatttgatagtaccggatatgataaagacttagtagaagctttggaaagagatataatt
tcccagaatcccaatgttcgatgggatgatatcgctgatttagtagaagctaaaaagttg
cttaaggaagccgtagtgttaccaatgtggatgcccgaattctttaagggcattaggaga
ccatggaaaggagtactgatggtcggcccacctggcacggggaagacgctccttgctaaa
gcagtagctacagaatgcaagacaacattcttcaatgtctcttcatcaactttgacttcc
aaatacagaggagaatctgagaagcttgttcgtcttctgtttgaaatggctcgattttat
tctccagccaccatatttattgatgagatagactccatctgtagtcgccgagggacttct
gaagaacatgaagcaagcagaagggtgaaagcggagctgctggttcagatggatggtgtt
ggaggtacttctgaaaatgatgacccttccaaaatggttatggttctggcagctactaat
tttccctgggatatagatgaggctttaagacgacgccttgagaaacgaatctatattcct
ttgccgtcagcaaaaggcagggaggagctattacgaataagtctacgtgagttggaattg
gctgatgatgttgaccttgcaagtatagcagaaaacatggaaggttattcaggtgcggac
attaccaacgtgtgcagggatgcgtccttgatggcaatgagaaggcgcattgaaggtttg
actccagaggaaatccgaaatctttccaaagaagaaatgcacatgcctacaactatggag
gatttcgagatggctttaaaaaaggtttctaagtcagtgtctgctgcagacattgaaaga
tacgagaaatggatatttgagtttggatcatgctaa

DBGET integrated database retrieval system