KEGG   Homo sapiens (human): 1111Help
Entry
1111              CDS       T01001                                 

Gene name
CHEK1, CHK1
Definition
(RefSeq) checkpoint kinase 1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa05166  Human T-cell leukemia virus 1 infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06230  Cell cycle G1/S
  Element
N00455  CDC25-Cell cycle G2/M
N00456  HIV Vpr to CDC25-cell cycle G2M
N00459  WEE1-Cell cycle G2/M
N00499  ATR-p21-Cell cycle G2/M
N00500  HTLV-1 Tax to p21-cell cycle G2/M
Drug target
Prexasertib: D11206
Rabusertib: D10397
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1111 (CHEK1)
   04115 p53 signaling pathway
    1111 (CHEK1)
   04218 Cellular senescence
    1111 (CHEK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1111 (CHEK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1111 (CHEK1)
   05170 Human immunodeficiency virus 1 infection
    1111 (CHEK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1111 (CHEK1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1111 (CHEK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1111 (CHEK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   1111 (CHEK1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    1111 (CHEK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 1111
NCBI-ProteinID: NP_001107593
OMIM: 603078
HGNC: 1925
Ensembl: ENSG00000149554
Vega: OTTHUMG00000165853
Pharos: O14757(Tchem)
UniProt: O14757 B4DT73
Structure
PDB: 

Position
11q24.2
AA seq 476 aa AA seqDB search
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgccctttgtggaagactgggacttggtgcaaaccctgggagaaggtgcctat
ggagaagttcaacttgctgtgaatagagtaactgaagaagcagtcgcagtgaagattgta
gatatgaagcgtgccgtagactgtccagaaaatattaagaaagagatctgtatcaataaa
atgctaaatcatgaaaatgtagtaaaattctatggtcacaggagagaaggcaatatccaa
tatttatttctggagtactgtagtggaggagagctttttgacagaatagagccagacata
ggcatgcctgaaccagatgctcagagattcttccatcaactcatggcaggggtggtttat
ctgcatggtattggaataactcacagggatattaaaccagaaaatcttctgttggatgaa
agggataacctcaaaatctcagactttggcttggcaacagtatttcggtataataatcgt
gagcgtttgttgaacaagatgtgtggtactttaccatatgttgctccagaacttctgaag
agaagagaatttcatgcagaaccagttgatgtttggtcctgtggaatagtacttactgca
atgctcgctggagaattgccatgggaccaacccagtgacagctgtcaggagtattctgac
tggaaagaaaaaaaaacatacctcaacccttggaaaaaaatcgattctgctcctctagct
ctgctgcataaaatcttagttgagaatccatcagcaagaattaccattccagacatcaaa
aaagatagatggtacaacaaacccctcaagaaaggggcaaaaaggccccgagtcacttca
ggtggtgtgtcagagtctcccagtggattttctaagcacattcaatccaatttggacttc
tctccagtaaacagtgcttctagtgaagaaaatgtgaagtactccagttctcagccagaa
ccccgcacaggtctttccttatgggataccagcccctcatacattgataaattggtacaa
gggatcagcttttcccagcccacatgtcctgatcatatgcttttgaatagtcagttactt
ggcaccccaggatcctcacagaacccctggcagcggttggtcaaaagaatgacacgattc
tttaccaaattggatgcagacaaatcttatcaatgcctgaaagagacttgtgagaagttg
ggctatcaatggaagaaaagttgtatgaatcaggttactatatcaacaactgataggaga
aacaataaactcattttcaaagtgaatttgttagaaatggatgataaaatattggttgac
ttccggctttctaagggtgatggattggagttcaagagacacttcctgaagattaaaggg
aagctgattgatattgtgagcagccagaagatttggcttcctgccacatga

DBGET integrated database retrieval system