KEGG   Homo sapiens (human): 11113Help
Entry
11113             CDS       T01001                                 

Gene name
CIT, CITK, CRIK, MCPH17, STK21
Definition
(RefSeq) citron rho-interacting serine/threonine kinase
  KO
K16308  citron Rho-interacting kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    11113 (CIT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11113 (CIT)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   11113 (CIT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr PH C1_1 Pkinase_C Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 11113
NCBI-ProteinID: NP_009105
OMIM: 605629
HGNC: 1985
Ensembl: ENSG00000122966
Vega: OTTHUMG00000134325
Pharos: O14578(Tbio)
UniProt: O14578
Position
12q24.23
AA seq 2027 aa AA seqDB search
MLKFKYGARNPLDAGAAEPIASRASRLNLFFQGKPPFMTQQQMSPLSREGILDALFVLFE
ECSQPALMKIKHVSNFVRKYSDTIAELQELQPSAKDFEVRSLVGCGHFAEVQVVREKATG
DIYAMKVMKKKALLAQEQVSFFEEERNILSRSTSPWIPQLQYAFQDKNHLYLVMEYQPGG
DLLSLLNRYEDQLDENLIQFYLAELILAVHSVHLMGYVHRDIKPENILVDRTGHIKLVDF
GSAAKMNSNKMVNAKLPIGTPDYMAPEVLTVMNGDGKGTYGLDCDWWSVGVIAYEMIYGR
SPFAEGTSARTFNNIMNFQRFLKFPDDPKVSSDFLDLIQSLLCGQKERLKFEGLCCHPFF
SKIDWNNIRNSPPPFVPTLKSDDDTSNFDEPEKNSWVSSSPCQLSPSGFSGEELPFVGFS
YSKALGILGRSESVVSGLDSPAKTSSMEKKLLIKSKELQDSQDKCHKMEQEMTRLHRRVS
EVEAVLSQKEVELKASETQRSLLEQDLATYITECSSLKRSLEQARMEVSQEDDKALQLLH
DIREQSRKLQEIKEQEYQAQVEEMRLMMNQLEEDLVSARRRSDLYESELRESRLAAEEFK
RKATECQHKLLKAKDQGKPEVGEYAKLEKINAEQQLKIQELQEKLEKAVKASTEATELLQ
NIRQAKERAERELEKLQNREDSSEGIRKKLVEAEELEEKHREAQVSAQHLEVHLKQKEQH
YEEKIKVLDNQIKKDLADKETLENMMQRHEEEAHEKGKILSEQKAMINAMDSKIRSLEQR
IVELSEANKLAANSSLFTQRNMKAQEEMISELRQQKFYLETQAGKLEAQNRKLEEQLEKI
SHQDHSDKNRLLELETRLREVSLEHEEQKLELKRQLTELQLSLQERESQLTALQAARAAL
ESQLRQAKTELEETTAEAEEEIQALTAHRDEIQRKFDALRNSCTVITDLEEQLNQLTEDN
AELNNQNFYLSKQLDEASGANDEIVQLRSEVDHLRREITEREMQLTSQKQTMEALKTTCT
MLEEQVMDLEALNDELLEKERQWEAWRSVLGDEKSQFECRVRELQRMLDTEKQSRARADQ
RITESRQVVELAVKEHKAEILALQQALKEQKLKAESLSDKLNDLEKKHAMLEMNARSLQQ
KLETERELKQRLLEEQAKLQQQMDLQKNHIFRLTQGLQEALDRADLLKTERSDLEYQLEN
IQVLYSHEKVKMEGTISQQTKLIDFLQAKMDQPAKKKKGLFSRRKEDPALPTQVPLQYNE
LKLALEKEKARCAELEEALQKTRIELRSAREEAAHRKATDHPHPSTPATARQQIAMSAIV
RSPEHQPSAMSLLAPPSSRRKESSTPEEFSRRLKERMHHNIPHRFNVGLNMRATKCAVCL
DTVHFGRQASKCLECQVMCHPKCSTCLPATCGLPAEYATHFTEAFCRDKMNSPGLQTKEP
SSSLHLEGWMKVPRNNKRGQQGWDRKYIVLEGSKVLIYDNEAREAGQRPVEEFELCLPDG
DVSIHGAVGASELANTAKADVPYILKMESHPHTTCWPGRTLYLLAPSFPDKQRWVTALES
VVAGGRVSREKAEADAKLLGNSLLKLEGDDRLDMNCTLPFSDQVVLVGTEEGLYALNVLK
NSLTHVPGIGAVFQIYIIKDLEKLLMIAGEERALCLVDVKKVKQSLAQSHLPAQPDISPN
IFEAVKGCHLFGAGKIENGLCICAAMPSKVVILRYNENLSKYCIRKEIETSEPCSCIHFT
NYSILIGTNKFYEIDMKQYTLEEFLDKNDHSLAPAVFAASSNSFPVSIVQVNSAGQREEY
LLCFHEFGVFVDSYGRRSRTDDLKWSRLPLAFAYREPYLFVTHFNSLEVIEIQARSSAGT
PARAYLDIPNPRYLGPAISSGAIYLASSYQDKLRVICCKGNLVKESGTEHHRGPSTSRSS
PNKRGPPTYNEHITKRVASSPAPPEGPSHPREPSTPHRYREGRTELRRDKSPGRPLEREK
SPGRMLSTRRERSPGRLFEDSSRGRLPAGAVRTPLSQVNKVWDQSSV
NT seq 6084 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttcaaatatggagcgcggaatcctttggatgctggtgctgctgaacccatt
gccagccgggcctccaggctgaatctgttcttccaggggaaaccaccctttatgactcaa
cagcagatgtctcctctttcccgagaagggatattagatgccctctttgttctctttgaa
gaatgcagtcagcctgctctgatgaagattaagcacgtgagcaactttgtccggaagtat
tccgacaccatagctgagttacaggagctccagccttcggcaaaggacttcgaagtcaga
agtcttgtaggttgtggtcactttgctgaagtgcaggtggtaagagagaaagcaaccggg
gacatctatgctatgaaagtgatgaagaagaaggctttattggcccaggagcaggtttca
ttttttgaggaagagcggaacatattatctcgaagcacaagcccgtggatcccccaatta
cagtatgcctttcaggacaaaaatcacctttatctggtcatggaatatcagcctggaggg
gacttgctgtcacttttgaatagatatgaggaccagttagatgaaaacctgatacagttt
tacctagctgagctgattttggctgttcacagcgttcatctgatgggatacgtgcatcga
gacatcaagcctgagaacattctcgttgaccgcacaggacacatcaagctggtggatttt
ggatctgccgcgaaaatgaattcaaacaagatggtgaatgccaaactcccgattgggacc
ccagattacatggctcctgaagtgctgactgtgatgaacggggatggaaaaggcacctac
ggcctggactgtgactggtggtcagtgggcgtgattgcctatgagatgatttatgggaga
tcccccttcgcagagggaacctctgccagaaccttcaataacattatgaatttccagcgg
tttttgaaatttccagatgaccccaaagtgagcagtgactttcttgatctgattcaaagc
ttgttgtgcggccagaaagagagactgaagtttgaaggtctttgctgccatcctttcttc
tctaaaattgactggaacaacattcgtaactctcctccccccttcgttcccaccctcaag
tctgacgatgacacctccaattttgatgaaccagagaagaattcgtgggtttcatcctct
ccgtgccagctgagcccctcaggcttctcgggtgaagaactgccgtttgtggggttttcg
tacagcaaggcactggggattcttggtagatctgagtctgttgtgtcgggtctggactcc
cctgccaagactagctccatggaaaagaaacttctcatcaaaagcaaagagctacaagac
tctcaggacaagtgtcacaagatggagcaggaaatgacccggttacatcggagagtgtca
gaggtggaggctgtgcttagtcagaaggaggtggagctgaaggcctctgagactcagaga
tccctcctggagcaggaccttgctacctacatcacagaatgcagtagcttaaagcgaagt
ttggagcaagcacggatggaggtgtcccaggaggatgacaaagcactgcagcttctccat
gatatcagagagcagagccggaagctccaagaaatcaaagagcaggagtaccaggctcaa
gtggaagaaatgaggttgatgatgaatcagttggaagaggatcttgtctcagcaagaaga
cggagtgatctctacgaatctgagctgagagagtctcggcttgctgctgaagaattcaag
cggaaagcgacagaatgtcagcataaactgttgaaggctaaggatcaagggaagcctgaa
gtgggagaatatgcgaaactggagaagatcaatgctgagcagcagctcaaaattcaggag
ctccaagagaaactggagaaggctgtaaaagccagcacggaggccaccgagctgctgcag
aatatccgccaggcaaaggagcgagccgagagggagctggagaagctgcagaaccgagag
gattcttctgaaggcatcagaaagaagctggtggaagctgaggagctcgaagagaaacat
cgggaggcccaagtctcagcccagcacctagaagtgcacctgaaacagaaagagcagcac
tatgaggaaaagattaaagtgttggacaatcagataaagaaagacctggctgacaaggag
acactggagaacatgatgcagagacacgaggaggaggcccatgagaagggcaaaattctc
agcgaacagaaggcgatgatcaatgctatggattccaagatcagatccctggaacagagg
attgtggaactgtctgaagccaataaacttgcagcaaatagcagtctttttacccaaagg
aacatgaaggcccaagaagagatgatttctgaactcaggcaacagaaattttacctggag
acacaggctgggaagttggaggcccagaaccgaaaactggaggagcagctggagaagatc
agccaccaagaccacagtgacaagaatcggctgctggaactggagacaagattgcgggag
gtcagtctagagcacgaggagcagaaactggagctcaagcgccagctcacagagctacag
ctctccctgcaggagcgcgagtcacagttgacagccctgcaggctgcacgggcggccctg
gagagccagcttcgccaggcgaagacagagctggaagagaccacagcagaagctgaagag
gagatccaggcactcacggcacatagagatgaaatccagcgcaaatttgatgctcttcgt
aacagctgtactgtaatcacagacctggaggagcagctaaaccagctgaccgaggacaac
gctgaactcaacaaccaaaacttctacttgtccaaacaactcgatgaggcttctggcgcc
aacgacgagattgtacaactgcgaagtgaagtggaccatctccgccgggagatcacggaa
cgagagatgcagcttaccagccagaagcaaacgatggaggctctgaagaccacgtgcacc
atgctggaggaacaggtcatggatttggaggccctaaacgatgagctgctagaaaaagag
cggcagtgggaggcctggaggagcgtcctgggtgatgagaaatcccagtttgagtgtcgg
gttcgagagctgcagagaatgctggacaccgagaaacagagcagggcgagagccgatcag
cggatcaccgagtctcgccaggtggtggagctggcagtgaaggagcacaaggctgagatt
ctcgctctgcagcaggctctcaaagagcagaagctgaaggccgagagcctctctgacaag
ctcaatgacctggagaagaagcatgctatgcttgaaatgaatgcccgaagcttacagcag
aagctggagactgaacgagagctcaaacagaggcttctggaagagcaagccaaattacag
cagcagatggacctgcagaaaaatcacattttccgtctgactcaaggactgcaagaagct
ctagatcgggctgatctactgaagacagaaagaagtgacttggagtatcagctggaaaac
attcaggttctctattctcatgaaaaggtgaaaatggaaggcactatttctcaacaaacc
aaactcattgattttctgcaagccaaaatggaccaacctgctaaaaagaaaaagggttta
tttagtcgacggaaagaggaccctgctttacccacacaggttcctctgcagtacaatgag
ctgaagctggccctggagaaggagaaagctcgctgtgcagagctagaggaagcccttcag
aagacccgcatcgagctccggtccgcccgggaggaagctgcccaccgcaaagcaacggac
cacccacacccatccacgccagccaccgcgaggcagcagatcgccatgtccgccatcgtg
cggtcgccagagcaccagcccagtgccatgagcctgctggccccgccatccagccgcaga
aaggagtcttcaactccagaggaatttagtcggcgtcttaaggaacgcatgcaccacaat
attcctcaccgattcaacgtaggactgaacatgcgagccacaaagtgtgctgtgtgtctg
gataccgtgcactttggacgccaggcatccaaatgtctcgaatgtcaggtgatgtgtcac
cccaagtgctccacgtgcttgccagccacctgcggcttgcctgctgaatatgccacacac
ttcaccgaggccttctgccgtgacaaaatgaactccccaggtctccagaccaaggagccc
agcagcagcttgcacctggaagggtggatgaaggtgcccaggaataacaaacgaggacag
caaggctgggacaggaagtacattgtcctggagggatcaaaagtcctcatttatgacaat
gaagccagagaagctggacagaggccggtggaagaatttgagctgtgccttcccgacggg
gatgtatctattcatggtgccgttggtgcttccgaactcgcaaatacagccaaagcagat
gtcccatacatactgaagatggaatctcacccgcacaccacctgctggcccgggagaacc
ctctacttgctagctcccagcttccctgacaaacagcgctgggtcaccgccttagaatca
gttgtcgcaggtgggagagtttctagggaaaaagcagaagctgatgctaaactgcttgga
aactccctgctgaaactggaaggtgatgaccgtctagacatgaactgcacgctgcccttc
agtgaccaggtggtgttggtgggcaccgaggaagggctctacgccctgaatgtcttgaaa
aactccctaacccatgtcccaggaattggagcagtcttccaaatttatattatcaaggac
ctggagaagctactcatgatagcaggagaagagcgggcactgtgtcttgtggacgtgaag
aaagtgaaacagtccctggcccagtcccacctgcctgcccagcccgacatctcacccaac
atttttgaagctgtcaagggctgccacttgtttggggcaggcaagattgagaacgggctc
tgcatctgtgcagccatgcccagcaaagtcgtcattctccgctacaacgaaaacctcagc
aaatactgcatccggaaagagatagagacctcagagccctgcagctgtatccacttcacc
aattacagtatcctcattggaaccaataaattctacgaaatcgacatgaagcagtacacg
ctcgaggaattcctggataagaatgaccattccttggcacctgctgtgtttgccgcctct
tccaacagcttccctgtctcaatcgtgcaggtgaacagcgcagggcagcgagaggagtac
ttgctgtgtttccacgaatttggagtgttcgtggattcttacggaagacgtagccgcaca
gacgatctcaagtggagtcgcttacctttggcctttgcctacagagaaccctatctgttt
gtgacccacttcaactcactcgaagtaattgagatccaggcacgctcctcagcagggacc
cctgcccgagcgtacctggacatcccgaacccgcgctacctgggccctgccatttcctca
ggagcgatttacttggcgtcctcataccaggataaattaagggtcatttgctgcaaggga
aacctcgtgaaggagtccggcactgaacaccaccggggcccgtccacctcccgcagcagc
cccaacaagcgaggcccacccacgtacaacgagcacatcaccaagcgcgtggcctccagc
ccagcgccgcccgaaggccccagccacccgcgagagccaagcacaccccaccgctaccgc
gaggggcggaccgagctgcgcagggacaagtctcctggccgccccctggagcgagagaag
tcccccggccggatgctcagcacgcggagagagcggtcccccgggaggctgtttgaagac
agcagcaggggccggctgcctgcgggagccgtgaggaccccgctgtcccaggtgaacaag
gtctgggaccagtcttcagtataa

DBGET integrated database retrieval system