KEGG   Homo sapiens (human): 11116
Entry
11116             CDS       T01001                                 

Gene name
CEP43, FGFR1OP, FOP
Definition
(RefSeq) centrosomal protein 43
  KO
K16546  FGFR1 oncogene partner
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    11116 (CEP43)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     11116 (CEP43)
SSDB
Motif
Pfam: FOP_dimer LisH_2
Other DBs
NCBI-GeneID: 11116
NCBI-ProteinID: NP_008976
OMIM: 605392
HGNC: 17012
Ensembl: ENSG00000213066
Vega: OTTHUMG00000016011
Pharos: O95684(Tbio)
UniProt: O95684
Structure
PDB: 
2D68

Position
6q27
AA seq 399 aa
MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE
SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAE
GTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQ
GKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDK
AGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAP
SLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIE
EDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcggcgacggcggccgcagtggtggccgaggaggacacggagctgcgggacctgctg
gtgcagacgctggagaacagcggggtcctgaaccgcatcaaggctgaactccgagcagct
gtgtttttagcactagaggagcaagaaaaagtagagaacaaaactcctttagttaatgag
agcctgaaaaagtttttaaataccaaagacggtcgtttagtggctagtcttgttgcagaa
tttcttcagttttttaaccttgactttactttggctgtttttcaacctgaaactagcaca
ctgcaaggtctcgaaggtcgagagaatttagcccgagatttaggtataattgaagcagaa
ggtactgtgggtggacccttattattagaagtgatcaggcgctgtcaacagaaagaaaaa
gggccaaccactggggaaggtgcacttgatctatctgatgtacattctccaccaaagtca
ccagagggaaaaacaagtgcacagacaacaccaagtaagataccaaggtataaaggacaa
ggtaagaagaagacaagcgggcagaaggctggtgacaagaaggccaatgatgaggccaat
cagagtgatacaagtgtctccttgtcagaacccaagagcaaaagcagccttcacttactg
tcccatgaaacaaaaattggatcttttctaagcaacagaactttagatggcaaagacaaa
gctggcctttgtccagatgaagatgatatggaaggagattctttctttgatgatcccatt
cctaagccagagaaaacttacggtttgaggaaggaacctaggaagcaagcaggaagtctg
gcctcgctctcggatgcaccccccttaaaaagtggactcagctccctggcgggagcccct
tctttaaaagactctgagagtaaaaggggaaatacagttttgaaagatctgaaattgatc
agtgataaaattggatcacttggattaggaactggagaagatgatgactatgttgatgat
tttaatagtaccagccatcgctcagagaaaagtgagataagtattggtgaagagatagaa
gaagacctttctgtggaaatagatgacatcaataccagtgataagcttgatgacctcaca
caagatctgactgtatcccagctcagtgatgttgcggattatctggaagatgttgcatag

DBGET integrated database retrieval system