KEGG   Homo sapiens (human): 11117
Entry
11117             CDS       T01001                                 

Gene name
EMILIN1, EMI, EMILIN, gp115
Definition
(RefSeq) elastin microfibril interfacer 1
  KO
K24246   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EMI C1q Collagen MscS_porin HAUS-augmin3 DUF5713 Wtap OCRE
Other DBs
NCBI-GeneID: 11117
NCBI-ProteinID: NP_008977
OMIM: 130660
HGNC: 19880
Ensembl: ENSG00000138080
Vega: OTTHUMG00000097069
Pharos: Q9Y6C2(Tbio)
UniProt: Q9Y6C2
Structure
PDB: 
2KA3 2OII

Position
2p23.3
AA seq 1016 aa
MAPRTLWSCYLCCLLTAAAGAASYPPRGFSLYTGSSGALSPGGPQAQIAPRPASRHRNWC
AYVVTRTVSCVLEDGVETYVKYQPCAWGQPQCPQSIMYRRFLRPRYRVAYKTVTDMEWRC
CQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQ
LEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNEI
QHQLQLLDTRVSTHDQELGHLNNHHGGSSSSGGSRAPAPASAPPGPSEELLRQLEQRLQE
SCSVCLAGLDGFRRQQQEDRERLRAMEKLLASVEERQRHLAGLAVGRRPPQECCSPELGR
RLAELERRLDVVAGSVTVLSGRRGTELGGAAGQGGHPPGYTSLASRLSRLEDRFNSTLGP
SEEQEESWPGAPGGLSHWLPAARGRLEQLGGLLANVSGELGGRLDLLEEQVAGAMQACGQ
LCSGAPGEQDSQVSEILSALERRVLDSEGQLRLVGSGLHTVEAAGEARQATLEGLQEVVG
RLQDRVDAQDETAAEFTLRLNLTAARLGQLEGLLQAHGDEGCGACGGVQEELGRLRDGVE
RCSCPLLPPRGPGAGPGVGGPSRGPLDGFSVFGGSSGSALQALQGELSEVILSFSSLNDS
LNELQTTVEGQGADLADLGATKDRIISEINRLQQEATEHATESEERFRGLEEGQAQAGQC
PSLEGRLGRLEGVCERLDTVAGGLQGLREGLSRHVAGLWAGLRETNTTSQMQAALLEKLV
GGQAGLGRRLGALNSSLQLLEDRLHQLSLKDLTGPAGEAGPPGPPGLQGPPGPAGPPGSP
GKDGQEGPIGPPGPQGEQGVEGAPAAPVPQVAFSAALSLPRSEPGTVPFDRVLLNDGGYY
DPETGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNQGVARVDSGGYEPEGLENKPVAE
SQPSPGTLGVFSLILPLQAGDTVCVDLVMGQLAHSEEPLTIFSGALLYGDPELEHA
NT seq 3051 nt   +upstreamnt  +downstreamnt
atggccccccgcaccctctggagctgctacctctgctgcctgctgacggcagctgcaggg
gccgccagctaccctcctcgaggtttcagcctctacacaggttccagtggggccctcagc
cccggggggccccaggcccagattgccccccggccagccagccgccacaggaactggtgt
gcctacgtggtgacccggacagtgagctgtgtccttgaggatggagtggagacatatgtc
aagtaccagccttgtgcctggggccagccccagtgtccccaaagcatcatgtaccgccgc
ttcctccgccctcgctaccgtgtggcctacaagacagtgaccgacatggagtggaggtgc
tgtcagggttatgggggcgatgactgtgctgagagtcccgctccagcgctggggcctgcg
tcttccacaccacggcccctggcccggcctgcccgccccaacctctctggctccagtgca
ggcagccccctcagtggactggggggagaaggtcctggggagtcagagaaggtgcagcag
ctggaggaacaggtgcagagcctgaccaaggagctgcaaggcctgcggggcgtcctgcaa
ggactgagcgggcgcctggcagaggatgtgcagagggctgtggagacggccttcaacggg
aggcagcagccagctgacgcggctgcccgccctggggtgcatgaaaccctcaatgagatc
cagcaccagctgcagctcctggacacccgcgtctccacccacgaccaggagctgggtcac
ctcaacaaccatcatggcggcagcagcagcagtgggggcagcagggccccagccccagcc
tcagcccctccgggccccagtgaggagctgctgcggcagctggagcagcggttgcaggag
tcctgctccgtgtgcctggccgggctagatggcttccgccggcagcagcaggaggacagg
gagcggctgcgagcgatggagaagctgctggcctcggtggaggagcggcaacggcacctc
gcagggctggcggtgggccgcaggccccctcaggaatgctgctctccagagctgggccgg
cgactggcagagctggagcgcaggctggatgtcgtggccggctcagtgacagtgctgagt
gggcggcgaggcacagagctgggaggagccgcggggcagggaggccaccccccaggctac
accagcttggcctcccgcctgtctcgcctggaggaccgcttcaactccaccctgggccct
tcggaggagcaggaggagagctggcctggggctcctggggggctgagccactggctgcct
gctgcccggggccgactagagcagttgggggggctgctggccaatgtgagcggggagctg
ggggggcggttggatctgttggaggagcaggtggcaggggccatgcaggcatgcgggcag
ctctgctctggggcccctggggagcaggactctcaagtcagcgagatcctcagtgccttg
gagcgcagggtgctggacagtgaggggcagctgcggctggtgggctccggcctgcacacg
gtggaagcagcgggggaggcccggcaggccacgctggagggattacaagaggttgtgggc
cggctccaggatcgtgtggatgcccaggatgagacagctgcagagttcacactacggctg
aatctcactgcggcccggctaggccaactggaggggctgctgcaggcccatggggatgag
ggctgtggggcctgtggcggagtccaagaggaactaggccgccttcgggatggtgtggag
cgctgctcctgccccctgttgcctcctcggggtcctggggctggtccaggtgttgggggc
ccaagccgtgggcccctggacggcttcagcgtgtttgggggcagctcaggctcagccctg
caggccctgcaaggagagctctctgaggttattctcagcttcagctccctcaatgactca
ctgaatgagctccagaccactgtggagggccagggcgctgatctggctgacctgggggca
accaaggaccgtatcatttctgagattaacaggctgcagcaggaggccacagagcatgct
acagagagtgaagagcgcttccgaggcctagaggagggacaagcacaggccggccagtgc
cccagcttagaggggcgattgggccgtcttgagggtgtctgtgaacggttggacactgtg
gctgggggactgcagggcctgcgcgagggcctttccagacacgtggctgggctctgggct
gggctccgggaaaccaacaccaccagccagatgcaggcagccctgctggagaagctggtc
gggggacaggcgggcctgggcaggcggctgggtgcccttaacagctccctgcagctcctg
gaggaccgtctgcaccagctcagcctgaaggacctcactgggcctgcaggagaggctggg
cccccagggcctcctgggctgcagggacccccaggccctgctggacctccaggatcacca
ggcaaggacgggcaagagggccccatcgggccaccaggtcctcaaggtgaacagggagtg
gagggggcaccagcagcccctgtgccccaagtggcattttcagctgctctgagtttgccc
cggtctgaaccaggcacggtccccttcgacagagtcctgctcaatgatggaggctattat
gatccagagacaggcgtgttcacagcgccactggctggacgctacttgctgagcgcggtg
ctgactgggcaccggcacgagaaagtggaggccgtgctgtcccgctccaaccagggcgtg
gcccgcgtagactccggtggctacgagcctgagggcctggagaataagccggtggccgag
agccagcccagcccgggcaccctgggcgtcttcagcctcatcctgccgctgcaggccggg
gacacggtctgcgtcgacctggtcatggggcagctggcgcactcggaggagccgctcacc
atcttcagcggggccctgctctatggggacccagagcttgaacacgcgtag

DBGET integrated database retrieval system