KEGG   Homo sapiens (human): 11127Help
Entry
11127             CDS       T01001                                 

Gene name
KIF3A, FLA10, KLP-20
Definition
(RefSeq) kinesin family member 3A
  KO
K10394  kinesin family member 3A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    11127 (KIF3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    11127 (KIF3A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     11127 (KIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 11127
NCBI-ProteinID: NP_008985
OMIM: 604683
HGNC: 6319
Ensembl: ENSG00000131437
Vega: OTTHUMG00000059725
Pharos: Q9Y496(Tbio)
UniProt: Q9Y496 Q05CT3
Position
5q31.1
AA seq 699 aa AA seqDB search
MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKT
FTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELR
GIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVY
IKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMH
VRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS
KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALL
RQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGKKKVSPDKMI
EMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVI
VGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQ
GKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDY
QEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESL
RQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaataaatcagagaagccagaaagctgcgataatgtgaaggttgttgttagg
tgccggcccctcaatgagagagagaaatcaatgtgctacaaacaggctgtcagtgtggat
gagatgaggggaactatcactgtacataagactgattcttccaatgaacctccaaagaca
tttacttttgatactgtttttggaccagagagtaaacaacttgatgtttataacttaact
gcaagacctattattgattctgtacttgaaggctacaatgggactatttttgcatatgga
caaaccggaacaggcaaaacttttaccatggaaggtgttcgagctattcctgaacttaga
ggaataattcccaattcatttgctcacatatttggtcatattgcaaaagcggagggtgat
acaagatttttggttcgagtgtcttatttggaaatatataatgaagaagttcgtgacctt
ttgggcaaggatcagacacaaaggttagaggttaaagaaagacctgatgtgggagtttat
atcaaagatttatcagcttatgtggtaaataatgctgatgatatggatagaattatgacg
ctaggccacaaaaatcgttctgttggtgcaactaatatgaacgaacatagttcccgttcc
catgccatctttacaattactatagaatgcagtgaaaaaggcattgatggtaacatgcat
gtcaggatggggaagctccatcttgtagatcttgctggttcagaaagacaggcaaaaact
ggagctactggacagcgcctaaaggaagctacaaaaatcaatctttcactttccaccctt
ggtaatgtaatttctgccttggttgatggaaaaagcactcatgtgccttatcgtaactct
aaactgactcgtcttcttcaggattccttaggaggaaattcaaaaaccatgatgtgtgca
aatattgggccagcagattacaattatgatgaaactatcagtacattacggtatgccaat
cgtgctaagaatattaaaaataaagctagaattaatgaagatccaaaggatgctttgctg
cgtcagttccagaaagaaatagaagaactgaaaaagaagcttgaagaaggagaagaaata
tcaggctctgatatcagtgggtcagaggaagatgatgatgaagagggtgaggttggagaa
gatggagagaaaaggaaaaaaagaaggggaaaaaagaaagtctccccagacaagatgatt
gaaatgcaagcaaaaattgatgaggagagaaaagcacttgaaacaaagctcgacatggaa
gaagaagaaagaaacaaggctagagctgaattagagaaacgggaaaaagatcttcttaaa
gcccaacaagagcatcagtctttgctggaaaaattatctgccctggaaaagaaggtaatt
gttggtggggttgacttgttggccaaagctgaggaacaagagaaacttcttgaagaatct
aacatggaactggaagaaaggaggaaaagagcagagcaacttcgcagagaacttgaggaa
aaagagcaagaacgcttggatattgaagaaaaatataccagtttgcaagaggaagcacag
ggaaagaccaagaagttaaagaaagtttggactatgctgatggctgcaaagtcagagatg
gctgatctccaacaagaacatcagagggaaattgaaggcctactggagaacattcggcaa
cttagccgggagcttcgacttcagatgcttattattgataactttatacctcgggattat
caggaaatgattgaaaactatgtccattggaatgaagacataggagaatggcagctaaaa
tgtgttgcttatacaggaaataacatgaggaagcaaaccccagtacctgataaaaaggag
aaagatccctttgaggtggacctttctcacgtgtatcttgcctatactgaggagagtctg
cgtcagtctttgatgaaactagaaagaccacgaacttcaaaggggaaagcaaggccaaag
acagggagaagaaagcgttctgcaaagcctgaaactgtaattgactctttactgcagtaa

DBGET integrated database retrieval system