KEGG   Homo sapiens (human): 1113Help
Entry
1113              CDS       T01001                                 

Gene name
CHGA, CGA
Definition
(RefSeq) chromogranin A
  KO
K19990  chromogranin-A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1113 (CHGA)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Others
   Others
    1113 (CHGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Granin PP1_bind
Motif
Other DBs
NCBI-GeneID: 1113
NCBI-ProteinID: NP_001266
OMIM: 118910
HGNC: 1929
Ensembl: ENSG00000100604
Vega: OTTHUMG00000171225
Pharos: P10645(Tbio)
UniProt: P10645 Q86T07
Position
14q32.12
AA seq 457 aa AA seqDB search
MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETL
RGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEA
VEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEA
TNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAG
EEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHS
QQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEG
QEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE
EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccgccgctgtcctggctcttctgctctgcgccgggcaagtcactgcgctccct
gtgaacagccctatgaataaaggggataccgaggtgatgaaatgcatcgttgaggtcatc
tccgacacactttccaagcccagccccatgcctgtcagccaggaatgttttgagacactc
cgaggagatgaacggatcctttccattctgagacatcagaatttactgaaggagctccaa
gacctcgctctccaaggcgccaaggagagggcacatcagcagaagaaacacagcggtttt
gaagatgaactctcagaggttcttgagaaccagagcagccaggccgagctgaaagaggcg
gtggaagagccatcatccaaggatgttatggagaaaagagaggattccaaggaggcagag
aaaagtggtgaagccacagacggagccaggccccaggccctcccggagcccatgcaggag
tccaaggctgaggggaacaatcaggcccctggggaggaagaggaggaggaggaggaggcc
accaacacccaccctccagccagcctccccagccagaaatacccaggcccacaggccgag
ggggacagtgagggcctctctcagggtctggtggacagagagaagggcctgagtgcagag
ccagggtggcaggcaaagagagaagaggaggaggaggaggaggaggaggctgaggctgga
gaggaggctgtccccgaggaagaaggccccactgtagtgctgaacccccacccgagcctt
ggctacaaggagatccggaaaggcgagagtcggtcggaggctctggctgtggatggagct
gggaagcctggggctgaggaggctcaggaccccgaagggaagggagaacaggagcactcc
cagcagaaagaggaggaggaggagatggcagtggtcccgcaaggcctcttccggggtggg
aagagcggagagctggagcaggaggaggagcggctctccaaggagtgggaggactccaaa
cgctggagcaagatggaccagctggccaaggagctgacggctgagaagcggctggagggg
caggaggaggaggaggacaaccgggacagttccatgaagctctccttccgggcccgggcc
tacggcttcaggggccctgggccgcagctgcgacgaggctggaggccatcctcccgggag
gacagccttgaggcgggcctgcccctccaggtccgaggctaccccgaggagaagaaagag
gaggagggcagcgcaaaccgcagaccagaggaccaggagctggagagcctgtcggccatt
gaagcagagctggagaaagtggcccaccagctgcaggcactacggcggggctga

DBGET integrated database retrieval system