KEGG   Homo sapiens (human): 11130Help
Entry
11130             CDS       T01001                                 

Gene name
ZWINT, HZwint-1, KNTC2AP, SIP30, ZWINT1
Definition
(RefSeq) ZW10 interacting kinetochore protein
  KO
K19943  ZW10 interactor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11130 (ZWINT)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    11130 (ZWINT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zwint Prominin V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 11130
NCBI-ProteinID: NP_008988
OMIM: 609177
HGNC: 13195
Ensembl: ENSG00000122952
Vega: OTTHUMG00000018261
Pharos: O95229(Tbio)
UniProt: O95229
Position
10q21.1
AA seq 277 aa AA seqDB search
MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVA
DFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQ
MEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTG
TQQELDRVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKP
QQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagcggagacagaggcggaagctgcagccctagaggtcctggctgaggtggca
ggcatcttggaacctgtaggcctgcaggaggaggcagaactgccagccaagatcctggtt
gagtttgtggtggactctcagaagaaagacaagctgctctgcagccagcttcaggtagcg
gatttcctgcagaacatcctggctcaggaggacactgctaagggtctcgaccccttggct
tctgaagacacgagccgacagaaggcaattgcagctaaggaacaatggaaagagctgaag
gccacctacagggagcacgtagaggccatcaaaattggcctcaccaaggccctgactcag
atggaggaagcccagaggaaacggacacaactccgggaagcctttgagcagctccaggcc
aagaaacaaatggccatggagaaacgcagagcagtccagaaccagtggcagctacaacag
gagaagcatctgcagcatctggcggaggtttctgcagaggtgagggagcgtaagacaggg
actcagcaggagcttgacagggtgtttcagaaacttggaaacctgaagcagcaggcagaa
caggagcgggacaagctgcagaggtatcagaccttcctccagcttctgtataccctgcag
ggtaagctgttgttccctgaggctgaggctgaggcagagaatcttccagatgataaaccc
cagcagccgactcgaccccaggagcagagtacaggagacaccatggggagagaccctggt
gtgtccttcaaggctgttggtctacaacctgctggagatgtaaatttgccatga

DBGET integrated database retrieval system